Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 47070..47340 | Replicon | plasmid B |
Accession | NZ_CP010147 | ||
Organism | Escherichia coli strain D5 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | RG38_RS26245 | Protein ID | WP_001312861.1 |
Coordinates | 47182..47340 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 47070..47133 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG38_RS26200 | 42462..43433 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
RG38_RS26210 | 44400..44606 | + | 207 | WP_000275856.1 | hypothetical protein | - |
RG38_RS26215 | 44632..45171 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
RG38_RS26220 | 45239..45472 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
RG38_RS26225 | 45500..45697 | + | 198 | Protein_41 | hypothetical protein | - |
RG38_RS26230 | 45752..46186 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
RG38_RS26235 | 46183..46902 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
RG38_RS27870 | 46914..47102 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 46914..47138 | + | 225 | NuclAT_0 | - | - |
- | 46914..47138 | + | 225 | NuclAT_0 | - | - |
- | 46914..47138 | + | 225 | NuclAT_0 | - | - |
- | 46914..47138 | + | 225 | NuclAT_0 | - | - |
- | 47070..47133 | - | 64 | - | - | Antitoxin |
RG38_RS26245 | 47182..47340 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
RG38_RS26265 | 48261..48548 | + | 288 | WP_000107535.1 | hypothetical protein | - |
RG38_RS26270 | 48666..49487 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
RG38_RS26275 | 49784..50386 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
RG38_RS26285 | 50707..51090 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
RG38_RS26290 | 51277..51966 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | sitABCD | iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB | 1..88754 | 88754 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T50792 WP_001312861.1 NZ_CP010147:47182-47340 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T50792 NZ_CP010147:47182-47340 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT50792 NZ_CP010147:c47133-47070 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|