Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 605971..606191 | Replicon | chromosome |
Accession | NZ_CP010145 | ||
Organism | Escherichia coli strain D5 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | RG38_RS03265 | Protein ID | WP_000170963.1 |
Coordinates | 605971..606078 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 606125..606191 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG38_RS03240 | 601815..602897 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
RG38_RS03245 | 602897..603730 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
RG38_RS03250 | 603727..604119 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
RG38_RS03255 | 604123..604932 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
RG38_RS03260 | 604968..605822 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
RG38_RS03265 | 605971..606078 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
- | 606125..606191 | + | 67 | - | - | Antitoxin |
RG38_RS03275 | 606483..607583 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
RG38_RS03280 | 607853..608083 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
RG38_RS03285 | 608241..608936 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
RG38_RS03290 | 608980..609333 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
RG38_RS03295 | 609518..610912 | + | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T50765 WP_000170963.1 NZ_CP010145:c606078-605971 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T50765 NZ_CP010145:c606078-605971 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT50765 NZ_CP010145:606125-606191 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|