Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 35536..35800 | Replicon | plasmid B |
| Accession | NZ_CP010142 | ||
| Organism | Escherichia coli strain D3 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | RG36_RS27650 | Protein ID | WP_001387489.1 |
| Coordinates | 35648..35800 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 35536..35596 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG36_RS27635 | 31638..32708 | - | 1071 | WP_012783932.1 | IncI1-type conjugal transfer protein TrbB | - |
| RG36_RS27640 | 32727..33935 | - | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 34115..34172 | - | 58 | NuclAT_1 | - | - |
| - | 34115..34172 | - | 58 | NuclAT_1 | - | - |
| - | 34115..34172 | - | 58 | NuclAT_1 | - | - |
| - | 34115..34172 | - | 58 | NuclAT_1 | - | - |
| RG36_RS27645 | 34242..35333 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
| - | 35536..35596 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 35536..35596 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 35536..35596 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 35536..35596 | - | 61 | NuclAT_0 | - | Antitoxin |
| RG36_RS27650 | 35648..35800 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| RG36_RS27655 | 35872..36123 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| RG36_RS27660 | 36423..36719 | + | 297 | WP_011264046.1 | hypothetical protein | - |
| RG36_RS29550 | 36784..36960 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| RG36_RS27675 | 37352..37561 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| RG36_RS27680 | 37633..38295 | - | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| RG36_RS27685 | 38366..40534 | - | 2169 | WP_015508354.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / blaTEM-1B | - | 1..90974 | 90974 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T50732 WP_001387489.1 NZ_CP010142:35648-35800 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T50732 NZ_CP010142:35648-35800 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT50732 NZ_CP010142:c35596-35536 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|