Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 157048..157302 | Replicon | plasmid A |
Accession | NZ_CP010141 | ||
Organism | Escherichia coli strain D3 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | RG36_RS27245 | Protein ID | WP_001351576.1 |
Coordinates | 157096..157302 (+) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 157048..157109 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG36_RS27220 | 153796..154542 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
RG36_RS27225 | 154601..155461 | + | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
RG36_RS27230 | 155564..156124 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
RG36_RS27235 | 156260..156472 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
RG36_RS29525 | 156718..156792 | + | 75 | Protein_163 | endonuclease | - |
- | 157048..157109 | - | 62 | NuclAT_1 | - | Antitoxin |
- | 157048..157109 | - | 62 | NuclAT_1 | - | Antitoxin |
- | 157048..157109 | - | 62 | NuclAT_1 | - | Antitoxin |
- | 157048..157109 | - | 62 | NuclAT_1 | - | Antitoxin |
RG36_RS27245 | 157096..157302 | + | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
RG36_RS27250 | 157586..157843 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
RG36_RS27260 | 158075..158149 | + | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
RG36_RS27265 | 158142..158624 | + | 483 | WP_001273588.1 | hypothetical protein | - |
RG36_RS27270 | 158617..159180 | + | 564 | Protein_168 | incFII family plasmid replication initiator RepA | - |
RG36_RS27275 | 159372..160913 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
RG36_RS27280 | 160928..161674 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
RG36_RS27285 | 161761..162060 | + | 300 | Protein_171 | incFII family plasmid replication initiator RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / blaTEM-1B / tet(B) / catA1 / aadA5 / qacE / sul1 / blaCTX-M-55 / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..174041 | 174041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T50728 WP_001351576.1 NZ_CP010141:157096-157302 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T50728 NZ_CP010141:157096-157302 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT50728 NZ_CP010141:c157109-157048 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|