Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 118704..118973 | Replicon | plasmid A |
Accession | NZ_CP010141 | ||
Organism | Escherichia coli strain D3 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | RG36_RS27005 | Protein ID | WP_001312861.1 |
Coordinates | 118815..118973 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 118704..118769 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG36_RS26960 | 113923..114894 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
RG36_RS29520 | 116033..116239 | + | 207 | WP_000275856.1 | hypothetical protein | - |
RG36_RS26975 | 116265..116804 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
RG36_RS26980 | 116872..117105 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
RG36_RS26985 | 117133..117330 | + | 198 | Protein_116 | hypothetical protein | - |
RG36_RS26990 | 117385..117819 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
RG36_RS26995 | 117816..118535 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
RG36_RS29385 | 118547..118735 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 118547..118771 | + | 225 | NuclAT_0 | - | - |
- | 118547..118771 | + | 225 | NuclAT_0 | - | - |
- | 118547..118771 | + | 225 | NuclAT_0 | - | - |
- | 118547..118771 | + | 225 | NuclAT_0 | - | - |
- | 118704..118769 | + | 66 | - | - | Antitoxin |
RG36_RS27005 | 118815..118973 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
RG36_RS27025 | 119894..120181 | + | 288 | WP_000107535.1 | hypothetical protein | - |
RG36_RS27030 | 120299..121120 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
RG36_RS27035 | 121417..122019 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
RG36_RS27045 | 122340..122723 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
RG36_RS27050 | 122910..123599 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / blaTEM-1B / tet(B) / catA1 / aadA5 / qacE / sul1 / blaCTX-M-55 / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..174041 | 174041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T50724 WP_001312861.1 NZ_CP010141:118815-118973 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T50724 NZ_CP010141:118815-118973 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT50724 NZ_CP010141:118704-118769 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|