Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 13569..13839 | Replicon | plasmid A |
| Accession | NZ_CP010138 | ||
| Organism | Escherichia coli strain D2 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | RG35_RS25055 | Protein ID | WP_001312861.1 |
| Coordinates | 13681..13839 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 13569..13632 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG35_RS25025 | 9363..9890 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| RG35_RS25030 | 9946..10179 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| RG35_RS25035 | 10238..12196 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| RG35_RS25040 | 12251..12685 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| RG35_RS25045 | 12682..13401 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| RG35_RS27090 | 13413..13601 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 13413..13637 | + | 225 | NuclAT_0 | - | - |
| - | 13413..13637 | + | 225 | NuclAT_0 | - | - |
| - | 13413..13637 | + | 225 | NuclAT_0 | - | - |
| - | 13413..13637 | + | 225 | NuclAT_0 | - | - |
| - | 13569..13632 | - | 64 | - | - | Antitoxin |
| RG35_RS25055 | 13681..13839 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| RG35_RS25075 | 14758..15045 | + | 288 | WP_000107537.1 | hypothetical protein | - |
| RG35_RS25080 | 15166..15987 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| RG35_RS25085 | 16284..16931 | - | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
| RG35_RS25095 | 17217..17600 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
| RG35_RS25100 | 17794..18480 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
| RG35_RS25105 | 18574..18801 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId | - | 1..83922 | 83922 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T50692 WP_001312861.1 NZ_CP010138:13681-13839 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T50692 NZ_CP010138:13681-13839 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT50692 NZ_CP010138:c13632-13569 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|