Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2804880..2805137 | Replicon | chromosome |
Accession | NZ_CP010134 | ||
Organism | Escherichia coli strain D1 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | V0YDF1 |
Locus tag | RG34_RS14560 | Protein ID | WP_001135738.1 |
Coordinates | 2804985..2805137 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 2804880..2804934 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG34_RS14540 | 2800105..2801100 | - | 996 | WP_001182653.1 | O-acetyltransferase WecH | - |
RG34_RS14545 | 2801275..2801574 | + | 300 | WP_000980104.1 | membrane protein | - |
RG34_RS14550 | 2801669..2802580 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
RG34_RS14555 | 2802590..2804659 | + | 2070 | WP_001291774.1 | glycine--tRNA ligase subunit beta | - |
- | 2804880..2804934 | - | 55 | - | - | Antitoxin |
RG34_RS14560 | 2804985..2805137 | + | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
RG34_RS29260 | 2805126..2805185 | - | 60 | WP_212591412.1 | hypothetical protein | - |
RG34_RS14565 | 2805325..2805537 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
RG34_RS14570 | 2805818..2806108 | - | 291 | WP_000455798.1 | HTH-type transcriptional regulator | - |
RG34_RS14575 | 2806542..2807252 | + | 711 | WP_000190516.1 | DUF3053 domain-containing protein | - |
RG34_RS14580 | 2807302..2808276 | - | 975 | WP_000805027.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
RG34_RS14585 | 2808380..2809039 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T50651 WP_001135738.1 NZ_CP010134:2804985-2805137 [Escherichia coli]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T50651 NZ_CP010134:2804985-2805137 [Escherichia coli]
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT50651 NZ_CP010134:c2804934-2804880 [Escherichia coli]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|