Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1856429..1856687 | Replicon | chromosome |
Accession | NZ_CP010134 | ||
Organism | Escherichia coli strain D1 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | RG34_RS09630 | Protein ID | WP_000809168.1 |
Coordinates | 1856535..1856687 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 1856429..1856486 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG34_RS09605 | 1851454..1852806 | + | 1353 | Protein_1719 | fimbria/pilus outer membrane usher protein | - |
RG34_RS28620 | 1852819..1853779 | + | 961 | Protein_1720 | fimbrial family protein | - |
RG34_RS09620 | 1853818..1854717 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
RG34_RS09625 | 1854783..1855949 | - | 1167 | WP_073514610.1 | Na+/H+ antiporter NhaA | - |
- | 1856429..1856486 | - | 58 | - | - | Antitoxin |
RG34_RS09630 | 1856535..1856687 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
RG34_RS09635 | 1856791..1857921 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
RG34_RS09640 | 1858010..1859926 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
RG34_RS09645 | 1860303..1860707 | + | 405 | WP_000843559.1 | DUF2541 family protein | - |
RG34_RS09650 | 1860733..1861446 | + | 714 | WP_001102379.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T50647 WP_000809168.1 NZ_CP010134:1856535-1856687 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T50647 NZ_CP010134:1856535-1856687 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTAGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTAGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT50647 NZ_CP010134:c1856486-1856429 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATAGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATAGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|