Detailed information of TA system TA050641

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 5244593..5244814
• Replicon: chromosome
• Accession: NZ_CP010133
• Organism: Escherichia coli strain C11

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: RG33_RS27125
• Protein ID: WP_000170965.1
• Coordinates: 5244707..5244814 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	5244593..5244659 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
RG33_RS27095	5239872..5241266	-	1395	WP_033554468.1	inverse autotransporter invasin YchO	-
RG33_RS27100	5241451..5241804	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
RG33_RS27105	5241848..5242543	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
RG33_RS27110	5242701..5242931	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
RG33_RS27115	5243201..5244301	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	5244593..5244659	-	67	-	-	Antitoxin
RG33_RS27125	5244707..5244814	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	5245129..5245192	-	64	NuclAT_17	-	-
-	5245129..5245192	-	64	NuclAT_17	-	-
-	5245129..5245192	-	64	NuclAT_17	-	-
-	5245129..5245192	-	64	NuclAT_17	-	-
-	5245129..5245192	-	64	NuclAT_19	-	-
-	5245129..5245192	-	64	NuclAT_19	-	-
-	5245129..5245192	-	64	NuclAT_19	-	-
-	5245129..5245192	-	64	NuclAT_19	-	-
-	5245129..5245192	-	64	NuclAT_21	-	-
-	5245129..5245192	-	64	NuclAT_21	-	-
-	5245129..5245192	-	64	NuclAT_21	-	-
-	5245129..5245192	-	64	NuclAT_21	-	-
-	5245129..5245192	-	64	NuclAT_23	-	-
-	5245129..5245192	-	64	NuclAT_23	-	-
-	5245129..5245192	-	64	NuclAT_23	-	-
-	5245129..5245192	-	64	NuclAT_23	-	-
-	5245129..5245192	-	64	NuclAT_28	-	-
-	5245129..5245192	-	64	NuclAT_28	-	-
-	5245129..5245192	-	64	NuclAT_28	-	-
-	5245129..5245192	-	64	NuclAT_28	-	-
-	5245129..5245192	-	64	NuclAT_30	-	-
-	5245129..5245192	-	64	NuclAT_30	-	-
-	5245129..5245192	-	64	NuclAT_30	-	-
-	5245129..5245192	-	64	NuclAT_30	-	-
RG33_RS27135	5245242..5245349	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
RG33_RS27140	5245498..5246352	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
RG33_RS27145	5246388..5247197	-	810	WP_001257044.1	invasion regulator SirB1	-
RG33_RS27150	5247201..5247593	-	393	WP_000200392.1	invasion regulator SirB2	-
RG33_RS27155	5247590..5248423	-	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-
RG33_RS27160	5248423..5249505	-	1083	WP_000804726.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T50641 WP_000170965.1 NZ_CP010133:5244707-5244814 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T50641 NZ_CP010133:5244707-5244814 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT50641 NZ_CP010133:c5244659-5244593 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin