Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 5244593..5244814 | Replicon | chromosome |
| Accession | NZ_CP010133 | ||
| Organism | Escherichia coli strain C11 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | RG33_RS27125 | Protein ID | WP_000170965.1 |
| Coordinates | 5244707..5244814 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 5244593..5244659 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG33_RS27095 | 5239872..5241266 | - | 1395 | WP_033554468.1 | inverse autotransporter invasin YchO | - |
| RG33_RS27100 | 5241451..5241804 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| RG33_RS27105 | 5241848..5242543 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| RG33_RS27110 | 5242701..5242931 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| RG33_RS27115 | 5243201..5244301 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 5244593..5244659 | - | 67 | - | - | Antitoxin |
| RG33_RS27125 | 5244707..5244814 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 5245129..5245192 | - | 64 | NuclAT_17 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_17 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_17 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_17 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_19 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_19 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_19 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_19 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_21 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_21 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_21 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_21 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_23 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_23 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_23 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_23 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_28 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_28 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_28 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_28 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_30 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_30 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_30 | - | - |
| - | 5245129..5245192 | - | 64 | NuclAT_30 | - | - |
| RG33_RS27135 | 5245242..5245349 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| RG33_RS27140 | 5245498..5246352 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| RG33_RS27145 | 5246388..5247197 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| RG33_RS27150 | 5247201..5247593 | - | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| RG33_RS27155 | 5247590..5248423 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| RG33_RS27160 | 5248423..5249505 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T50641 WP_000170965.1 NZ_CP010133:5244707-5244814 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T50641 NZ_CP010133:5244707-5244814 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT50641 NZ_CP010133:c5244659-5244593 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|