Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3065278..3065499 | Replicon | chromosome |
| Accession | NZ_CP010132 | ||
| Organism | Escherichia coli strain C10 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | RG32_RS15915 | Protein ID | WP_000170965.1 |
| Coordinates | 3065278..3065385 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3065433..3065499 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG32_RS15880 | 3060587..3061669 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| RG32_RS15885 | 3061669..3062502 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| RG32_RS15890 | 3062499..3062891 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| RG32_RS15895 | 3062895..3063704 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| RG32_RS15900 | 3063740..3064594 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| RG32_RS15905 | 3064743..3064850 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3064900..3064963 | + | 64 | NuclAT_17 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_17 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_17 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_17 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_19 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_19 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_19 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_19 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_21 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_21 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_21 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_21 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_23 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_23 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_23 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_23 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_28 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_28 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_28 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_28 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_30 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_30 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_30 | - | - |
| - | 3064900..3064963 | + | 64 | NuclAT_30 | - | - |
| RG32_RS15915 | 3065278..3065385 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3065433..3065499 | + | 67 | - | - | Antitoxin |
| RG32_RS15920 | 3065791..3066891 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| RG32_RS15925 | 3067161..3067391 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| RG32_RS15930 | 3067549..3068244 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| RG32_RS15935 | 3068288..3068641 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| RG32_RS15940 | 3068826..3070220 | + | 1395 | WP_033554468.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T50601 WP_000170965.1 NZ_CP010132:c3065385-3065278 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T50601 NZ_CP010132:c3065385-3065278 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT50601 NZ_CP010132:3065433-3065499 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|