Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3064743..3064963 Replicon chromosome
Accession NZ_CP010132
Organism Escherichia coli strain C10

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag RG32_RS15905 Protein ID WP_000170954.1
Coordinates 3064743..3064850 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3064900..3064963 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG32_RS15880 3060587..3061669 + 1083 WP_000804726.1 peptide chain release factor 1 -
RG32_RS15885 3061669..3062502 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
RG32_RS15890 3062499..3062891 + 393 WP_000200392.1 invasion regulator SirB2 -
RG32_RS15895 3062895..3063704 + 810 WP_001257044.1 invasion regulator SirB1 -
RG32_RS15900 3063740..3064594 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
RG32_RS15905 3064743..3064850 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3064900..3064963 + 64 NuclAT_17 - Antitoxin
- 3064900..3064963 + 64 NuclAT_17 - Antitoxin
- 3064900..3064963 + 64 NuclAT_17 - Antitoxin
- 3064900..3064963 + 64 NuclAT_17 - Antitoxin
- 3064900..3064963 + 64 NuclAT_19 - Antitoxin
- 3064900..3064963 + 64 NuclAT_19 - Antitoxin
- 3064900..3064963 + 64 NuclAT_19 - Antitoxin
- 3064900..3064963 + 64 NuclAT_19 - Antitoxin
- 3064900..3064963 + 64 NuclAT_21 - Antitoxin
- 3064900..3064963 + 64 NuclAT_21 - Antitoxin
- 3064900..3064963 + 64 NuclAT_21 - Antitoxin
- 3064900..3064963 + 64 NuclAT_21 - Antitoxin
- 3064900..3064963 + 64 NuclAT_23 - Antitoxin
- 3064900..3064963 + 64 NuclAT_23 - Antitoxin
- 3064900..3064963 + 64 NuclAT_23 - Antitoxin
- 3064900..3064963 + 64 NuclAT_23 - Antitoxin
- 3064900..3064963 + 64 NuclAT_28 - Antitoxin
- 3064900..3064963 + 64 NuclAT_28 - Antitoxin
- 3064900..3064963 + 64 NuclAT_28 - Antitoxin
- 3064900..3064963 + 64 NuclAT_28 - Antitoxin
- 3064900..3064963 + 64 NuclAT_30 - Antitoxin
- 3064900..3064963 + 64 NuclAT_30 - Antitoxin
- 3064900..3064963 + 64 NuclAT_30 - Antitoxin
- 3064900..3064963 + 64 NuclAT_30 - Antitoxin
RG32_RS15915 3065278..3065385 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3065434..3065499 + 66 NuclAT_16 - -
- 3065434..3065499 + 66 NuclAT_16 - -
- 3065434..3065499 + 66 NuclAT_16 - -
- 3065434..3065499 + 66 NuclAT_16 - -
- 3065434..3065499 + 66 NuclAT_18 - -
- 3065434..3065499 + 66 NuclAT_18 - -
- 3065434..3065499 + 66 NuclAT_18 - -
- 3065434..3065499 + 66 NuclAT_18 - -
- 3065434..3065499 + 66 NuclAT_20 - -
- 3065434..3065499 + 66 NuclAT_20 - -
- 3065434..3065499 + 66 NuclAT_20 - -
- 3065434..3065499 + 66 NuclAT_20 - -
- 3065434..3065499 + 66 NuclAT_22 - -
- 3065434..3065499 + 66 NuclAT_22 - -
- 3065434..3065499 + 66 NuclAT_22 - -
- 3065434..3065499 + 66 NuclAT_22 - -
- 3065434..3065499 + 66 NuclAT_27 - -
- 3065434..3065499 + 66 NuclAT_27 - -
- 3065434..3065499 + 66 NuclAT_27 - -
- 3065434..3065499 + 66 NuclAT_27 - -
- 3065434..3065499 + 66 NuclAT_29 - -
- 3065434..3065499 + 66 NuclAT_29 - -
- 3065434..3065499 + 66 NuclAT_29 - -
- 3065434..3065499 + 66 NuclAT_29 - -
- 3065434..3065501 + 68 NuclAT_31 - -
- 3065434..3065501 + 68 NuclAT_31 - -
- 3065434..3065501 + 68 NuclAT_31 - -
- 3065434..3065501 + 68 NuclAT_31 - -
- 3065434..3065501 + 68 NuclAT_32 - -
- 3065434..3065501 + 68 NuclAT_32 - -
- 3065434..3065501 + 68 NuclAT_32 - -
- 3065434..3065501 + 68 NuclAT_32 - -
- 3065434..3065501 + 68 NuclAT_33 - -
- 3065434..3065501 + 68 NuclAT_33 - -
- 3065434..3065501 + 68 NuclAT_33 - -
- 3065434..3065501 + 68 NuclAT_33 - -
- 3065434..3065501 + 68 NuclAT_34 - -
- 3065434..3065501 + 68 NuclAT_34 - -
- 3065434..3065501 + 68 NuclAT_34 - -
- 3065434..3065501 + 68 NuclAT_34 - -
- 3065434..3065501 + 68 NuclAT_35 - -
- 3065434..3065501 + 68 NuclAT_35 - -
- 3065434..3065501 + 68 NuclAT_35 - -
- 3065434..3065501 + 68 NuclAT_35 - -
- 3065434..3065501 + 68 NuclAT_36 - -
- 3065434..3065501 + 68 NuclAT_36 - -
- 3065434..3065501 + 68 NuclAT_36 - -
- 3065434..3065501 + 68 NuclAT_36 - -
RG32_RS15920 3065791..3066891 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
RG32_RS15925 3067161..3067391 + 231 WP_001146442.1 putative cation transport regulator ChaB -
RG32_RS15930 3067549..3068244 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
RG32_RS15935 3068288..3068641 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T50597 WP_000170954.1 NZ_CP010132:c3064850-3064743 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T50597 NZ_CP010132:c3064850-3064743 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT50597 NZ_CP010132:3064900-3064963 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References