Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4887623..4887843 | Replicon | chromosome |
| Accession | NZ_CP010119 | ||
| Organism | Escherichia coli strain C3 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | RG26_RS26350 | Protein ID | WP_000170965.1 |
| Coordinates | 4887623..4887730 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4887777..4887843 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG26_RS26315 | 4882932..4884014 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| RG26_RS26320 | 4884014..4884847 | + | 834 | WP_000456459.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| RG26_RS26325 | 4884844..4885236 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| RG26_RS26330 | 4885240..4886049 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| RG26_RS26335 | 4886085..4886939 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| RG26_RS26340 | 4887088..4887195 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4887243..4887309 | + | 67 | NuclAT_32 | - | - |
| - | 4887243..4887309 | + | 67 | NuclAT_32 | - | - |
| - | 4887243..4887309 | + | 67 | NuclAT_32 | - | - |
| - | 4887243..4887309 | + | 67 | NuclAT_32 | - | - |
| - | 4887243..4887309 | + | 67 | NuclAT_34 | - | - |
| - | 4887243..4887309 | + | 67 | NuclAT_34 | - | - |
| - | 4887243..4887309 | + | 67 | NuclAT_34 | - | - |
| - | 4887243..4887309 | + | 67 | NuclAT_34 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_15 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_15 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_15 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_15 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_17 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_17 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_17 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_17 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_19 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_19 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_19 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_19 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_21 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_21 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_21 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_21 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_23 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_23 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_23 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_23 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_25 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_25 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_25 | - | - |
| - | 4887245..4887308 | + | 64 | NuclAT_25 | - | - |
| RG26_RS26350 | 4887623..4887730 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4887777..4887843 | + | 67 | - | - | Antitoxin |
| RG26_RS26360 | 4888135..4889235 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| RG26_RS26365 | 4889505..4889735 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| RG26_RS26370 | 4889893..4890588 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| RG26_RS26375 | 4890632..4890985 | - | 354 | WP_001169666.1 | DsrE/F sulfur relay family protein YchN | - |
| RG26_RS26380 | 4891170..4892564 | + | 1395 | WP_000086212.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T50434 WP_000170965.1 NZ_CP010119:c4887730-4887623 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T50434 NZ_CP010119:c4887730-4887623 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT50434 NZ_CP010119:4887777-4887843 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|