Detailed information of TA system TA050434

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4887623..4887843
• Replicon: chromosome
• Accession: NZ_CP010119
• Organism: Escherichia coli strain C3

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: RG26_RS26350
• Protein ID: WP_000170965.1
• Coordinates: 4887623..4887730 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4887777..4887843 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
RG26_RS26315	4882932..4884014	+	1083	WP_000804726.1	peptide chain release factor 1	-
RG26_RS26320	4884014..4884847	+	834	WP_000456459.1	peptide chain release factor N(5)-glutamine methyltransferase	-
RG26_RS26325	4884844..4885236	+	393	WP_000200392.1	invasion regulator SirB2	-
RG26_RS26330	4885240..4886049	+	810	WP_001257044.1	invasion regulator SirB1	-
RG26_RS26335	4886085..4886939	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
RG26_RS26340	4887088..4887195	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4887243..4887309	+	67	NuclAT_32	-	-
-	4887243..4887309	+	67	NuclAT_32	-	-
-	4887243..4887309	+	67	NuclAT_32	-	-
-	4887243..4887309	+	67	NuclAT_32	-	-
-	4887243..4887309	+	67	NuclAT_34	-	-
-	4887243..4887309	+	67	NuclAT_34	-	-
-	4887243..4887309	+	67	NuclAT_34	-	-
-	4887243..4887309	+	67	NuclAT_34	-	-
-	4887245..4887308	+	64	NuclAT_15	-	-
-	4887245..4887308	+	64	NuclAT_15	-	-
-	4887245..4887308	+	64	NuclAT_15	-	-
-	4887245..4887308	+	64	NuclAT_15	-	-
-	4887245..4887308	+	64	NuclAT_17	-	-
-	4887245..4887308	+	64	NuclAT_17	-	-
-	4887245..4887308	+	64	NuclAT_17	-	-
-	4887245..4887308	+	64	NuclAT_17	-	-
-	4887245..4887308	+	64	NuclAT_19	-	-
-	4887245..4887308	+	64	NuclAT_19	-	-
-	4887245..4887308	+	64	NuclAT_19	-	-
-	4887245..4887308	+	64	NuclAT_19	-	-
-	4887245..4887308	+	64	NuclAT_21	-	-
-	4887245..4887308	+	64	NuclAT_21	-	-
-	4887245..4887308	+	64	NuclAT_21	-	-
-	4887245..4887308	+	64	NuclAT_21	-	-
-	4887245..4887308	+	64	NuclAT_23	-	-
-	4887245..4887308	+	64	NuclAT_23	-	-
-	4887245..4887308	+	64	NuclAT_23	-	-
-	4887245..4887308	+	64	NuclAT_23	-	-
-	4887245..4887308	+	64	NuclAT_25	-	-
-	4887245..4887308	+	64	NuclAT_25	-	-
-	4887245..4887308	+	64	NuclAT_25	-	-
-	4887245..4887308	+	64	NuclAT_25	-	-
RG26_RS26350	4887623..4887730	-	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4887777..4887843	+	67	-	-	Antitoxin
RG26_RS26360	4888135..4889235	-	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
RG26_RS26365	4889505..4889735	+	231	WP_001146442.1	putative cation transport regulator ChaB	-
RG26_RS26370	4889893..4890588	+	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
RG26_RS26375	4890632..4890985	-	354	WP_001169666.1	DsrE/F sulfur relay family protein YchN	-
RG26_RS26380	4891170..4892564	+	1395	WP_000086212.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T50434 WP_000170965.1 NZ_CP010119:c4887730-4887623 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T50434 NZ_CP010119:c4887730-4887623 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT50434 NZ_CP010119:4887777-4887843 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin