Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1478817..1479038 Replicon chromosome
Accession NZ_CP009859
Organism Escherichia coli strain ECONIH1

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1D7PZ30
Locus tag ECONIH1_RS07435 Protein ID WP_022645587.1
Coordinates 1478817..1478924 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1478972..1479038 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECONIH1_RS07410 1474661..1475743 + 1083 WP_022645584.1 peptide chain release factor 1 -
ECONIH1_RS07415 1475743..1476576 + 834 WP_022645585.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECONIH1_RS07420 1476573..1476965 + 393 WP_000200374.1 invasion regulator SirB2 -
ECONIH1_RS07425 1476969..1477778 + 810 WP_022645586.1 invasion regulator SirB1 -
ECONIH1_RS07430 1477814..1478668 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ECONIH1_RS07435 1478817..1478924 - 108 WP_022645587.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1478972..1479038 + 67 NuclAT_30 - Antitoxin
- 1478972..1479038 + 67 NuclAT_30 - Antitoxin
- 1478972..1479038 + 67 NuclAT_30 - Antitoxin
- 1478972..1479038 + 67 NuclAT_30 - Antitoxin
- 1478972..1479038 + 67 NuclAT_32 - Antitoxin
- 1478972..1479038 + 67 NuclAT_32 - Antitoxin
- 1478972..1479038 + 67 NuclAT_32 - Antitoxin
- 1478972..1479038 + 67 NuclAT_32 - Antitoxin
- 1478972..1479038 + 67 NuclAT_34 - Antitoxin
- 1478972..1479038 + 67 NuclAT_34 - Antitoxin
- 1478972..1479038 + 67 NuclAT_34 - Antitoxin
- 1478972..1479038 + 67 NuclAT_34 - Antitoxin
- 1478972..1479038 + 67 NuclAT_36 - Antitoxin
- 1478972..1479038 + 67 NuclAT_36 - Antitoxin
- 1478972..1479038 + 67 NuclAT_36 - Antitoxin
- 1478972..1479038 + 67 NuclAT_36 - Antitoxin
- 1478972..1479038 + 67 NuclAT_38 - Antitoxin
- 1478972..1479038 + 67 NuclAT_38 - Antitoxin
- 1478972..1479038 + 67 NuclAT_38 - Antitoxin
- 1478972..1479038 + 67 NuclAT_38 - Antitoxin
- 1478972..1479038 + 67 NuclAT_40 - Antitoxin
- 1478972..1479038 + 67 NuclAT_40 - Antitoxin
- 1478972..1479038 + 67 NuclAT_40 - Antitoxin
- 1478972..1479038 + 67 NuclAT_40 - Antitoxin
- 1478974..1479031 + 58 NuclAT_43 - -
- 1478974..1479031 + 58 NuclAT_43 - -
- 1478974..1479031 + 58 NuclAT_43 - -
- 1478974..1479031 + 58 NuclAT_43 - -
- 1478974..1479031 + 58 NuclAT_45 - -
- 1478974..1479031 + 58 NuclAT_45 - -
- 1478974..1479031 + 58 NuclAT_45 - -
- 1478974..1479031 + 58 NuclAT_45 - -
ECONIH1_RS07440 1479352..1479459 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1479512..1479573 + 62 NuclAT_42 - -
- 1479512..1479573 + 62 NuclAT_42 - -
- 1479512..1479573 + 62 NuclAT_42 - -
- 1479512..1479573 + 62 NuclAT_42 - -
- 1479512..1479573 + 62 NuclAT_44 - -
- 1479512..1479573 + 62 NuclAT_44 - -
- 1479512..1479573 + 62 NuclAT_44 - -
- 1479512..1479573 + 62 NuclAT_44 - -
- 1479512..1479574 + 63 NuclAT_31 - -
- 1479512..1479574 + 63 NuclAT_31 - -
- 1479512..1479574 + 63 NuclAT_31 - -
- 1479512..1479574 + 63 NuclAT_31 - -
- 1479512..1479574 + 63 NuclAT_33 - -
- 1479512..1479574 + 63 NuclAT_33 - -
- 1479512..1479574 + 63 NuclAT_33 - -
- 1479512..1479574 + 63 NuclAT_33 - -
- 1479512..1479574 + 63 NuclAT_35 - -
- 1479512..1479574 + 63 NuclAT_35 - -
- 1479512..1479574 + 63 NuclAT_35 - -
- 1479512..1479574 + 63 NuclAT_35 - -
- 1479512..1479574 + 63 NuclAT_37 - -
- 1479512..1479574 + 63 NuclAT_37 - -
- 1479512..1479574 + 63 NuclAT_37 - -
- 1479512..1479574 + 63 NuclAT_37 - -
- 1479512..1479574 + 63 NuclAT_39 - -
- 1479512..1479574 + 63 NuclAT_39 - -
- 1479512..1479574 + 63 NuclAT_39 - -
- 1479512..1479574 + 63 NuclAT_39 - -
- 1479512..1479574 + 63 NuclAT_41 - -
- 1479512..1479574 + 63 NuclAT_41 - -
- 1479512..1479574 + 63 NuclAT_41 - -
- 1479512..1479574 + 63 NuclAT_41 - -
ECONIH1_RS07445 1479865..1480965 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
ECONIH1_RS07450 1481235..1481465 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ECONIH1_RS07455 1481623..1482318 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
ECONIH1_RS07460 1482362..1482715 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4029.82 Da        Isoelectric Point: 11.4779

>T50014 WP_022645587.1 NZ_CP009859:c1478924-1478817 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T50014 NZ_CP009859:c1478924-1478817 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT50014 NZ_CP009859:1478972-1479038 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGGTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1D7PZ30

Antitoxin

Download structure file

References