Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2374833..2375017 | Replicon | chromosome |
Accession | NZ_CP009828 | ||
Organism | Staphylococcus aureus strain MS4 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NI36_RS12020 | Protein ID | WP_000482647.1 |
Coordinates | 2374910..2375017 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2374833..2374893 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NI36_RS12010 | 2370741..2372474 | - | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein/permease | - |
NI36_RS12015 | 2372550..2374262 | - | 1713 | WP_001064821.1 | ABC transporter ATP-binding protein/permease | - |
NI36_RS14610 | 2374716..2374883 | - | 168 | WP_000301893.1 | hypothetical protein | - |
- | 2374833..2374893 | + | 61 | - | - | Antitoxin |
NI36_RS12020 | 2374910..2375017 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NI36_RS12025 | 2375150..2375536 | - | 387 | WP_000779353.1 | flippase GtxA | - |
NI36_RS12030 | 2375804..2376946 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NI36_RS12035 | 2377006..2377665 | + | 660 | WP_000831298.1 | membrane protein | - |
NI36_RS12040 | 2377848..2379059 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
NI36_RS12045 | 2379182..2379655 | - | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2368748..2370394 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T49907 WP_000482647.1 NZ_CP009828:c2375017-2374910 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T49907 NZ_CP009828:c2375017-2374910 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT49907 NZ_CP009828:2374833-2374893 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|