Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrG/- |
Location | 2189954..2190204 | Replicon | chromosome |
Accession | NZ_CP009748 | ||
Organism | Bacillus subtilis strain ATCC 13952 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | KS08_RS20355 | Protein ID | WP_009967548.1 |
Coordinates | 2189954..2190070 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2190065..2190204 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KS08_RS10870 | 2185091..2185351 | + | 261 | WP_014472510.1 | hypothetical protein | - |
KS08_RS10875 | 2185503..2186665 | + | 1163 | Protein_2142 | tetratricopeptide repeat protein | - |
KS08_RS10880 | 2186829..2188079 | - | 1251 | WP_014470073.1 | UV-damage repair protein uvrX | - |
KS08_RS10885 | 2188072..2188404 | - | 333 | WP_014470072.1 | YolD-like family protein | - |
KS08_RS10890 | 2188623..2189287 | - | 665 | Protein_2145 | sporulation protein YunB | - |
KS08_RS10895 | 2189522..2189725 | - | 204 | WP_014470071.1 | hypothetical protein | - |
KS08_RS20355 | 2189954..2190070 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- | 2190065..2190204 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2190065..2190204 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2190065..2190204 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2190065..2190204 | - | 140 | NuclAT_0 | - | Antitoxin |
KS08_RS10900 | 2190378..2190836 | - | 459 | WP_014470070.1 | SMI1/KNR4 family protein | - |
KS08_RS10905 | 2190849..2192735 | - | 1887 | WP_014470069.1 | HNH endonuclease | - |
KS08_RS10910 | 2193242..2194012 | + | 771 | WP_014470068.1 | hypothetical protein | - |
KS08_RS10915 | 2194056..2194490 | - | 435 | WP_076982859.1 | SMI1/KNR4 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2049155..2197526 | 148371 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T49584 WP_009967548.1 NZ_CP009748:2189954-2190070 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T49584 NZ_CP009748:2189954-2190070 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 140 bp
>AT49584 NZ_CP009748:c2190204-2190065 [Bacillus subtilis]
AAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCACCCCGGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCG
ATGTTGAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
AAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCACCCCGGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCG
ATGTTGAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|