Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2233625..2233924 | Replicon | chromosome |
Accession | NZ_CP009681 | ||
Organism | Staphylococcus aureus strain Gv69 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | SAGV69_RS16620 | Protein ID | WP_011447039.1 |
Coordinates | 2233748..2233924 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2233625..2233680 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAGV69_RS11535 | 2229324..2229422 | - | 99 | WP_001803958.1 | hypothetical protein | - |
SAGV69_RS11540 | 2229518..2230732 | + | 1215 | WP_000286469.1 | NADH-dependent flavin oxidoreductase | - |
SAGV69_RS11545 | 2230790..2231617 | + | 828 | WP_000136022.1 | alpha/beta hydrolase | - |
SAGV69_RS11550 | 2232515..2233270 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAGV69_RS11555 | 2233282..2233536 | - | 255 | WP_000611512.1 | phage holin | - |
SAGV69_RS11560 | 2233588..2233695 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2233617..2233756 | + | 140 | NuclAT_0 | - | - |
- | 2233617..2233756 | + | 140 | NuclAT_0 | - | - |
- | 2233617..2233756 | + | 140 | NuclAT_0 | - | - |
- | 2233617..2233756 | + | 140 | NuclAT_0 | - | - |
- | 2233625..2233680 | + | 56 | - | - | Antitoxin |
SAGV69_RS16620 | 2233748..2233924 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
SAGV69_RS11570 | 2234074..2234370 | - | 297 | WP_042857037.1 | DUF2951 domain-containing protein | - |
SAGV69_RS17065 | 2234428..2234715 | - | 288 | Protein_2207 | hypothetical protein | - |
SAGV69_RS11580 | 2234762..2234915 | - | 154 | Protein_2208 | hypothetical protein | - |
SAGV69_RS16625 | 2234905..2238693 | - | 3789 | Protein_2209 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | tet(M) / aph(3')-III / ant(6)-Ia | hlb | 2117877..2271690 | 153813 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T49413 WP_011447039.1 NZ_CP009681:c2233924-2233748 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T49413 NZ_CP009681:c2233924-2233748 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGGTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGGTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT49413 NZ_CP009681:2233625-2233680 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|