Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 579265..579447 | Replicon | chromosome |
Accession | NZ_CP009681 | ||
Organism | Staphylococcus aureus strain Gv69 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAGV69_RS16915 | Protein ID | WP_001801861.1 |
Coordinates | 579352..579447 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 579265..579324 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAGV69_RS03025 | 576727..577899 | + | 1173 | Protein_560 | IS256 family transposase | - |
SAGV69_RS03035 | 578403..578780 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
SAGV69_RS16130 | 578974..579150 | + | 177 | Protein_562 | transposase | - |
SAGV69_RS03040 | 579128..579229 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 579265..579324 | + | 60 | - | - | Antitoxin |
SAGV69_RS16915 | 579352..579447 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
SAGV69_RS03045 | 579650..579793 | + | 144 | WP_001549059.1 | transposase | - |
SAGV69_RS03055 | 580397..580780 | + | 384 | WP_000070811.1 | hypothetical protein | - |
SAGV69_RS03060 | 580791..580967 | + | 177 | WP_000375476.1 | hypothetical protein | - |
SAGV69_RS03065 | 580969..581154 | + | 186 | WP_000809857.1 | hypothetical protein | - |
SAGV69_RS03070 | 581268..581909 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAGV69_RS03075 | 582127..582678 | - | 552 | WP_000414205.1 | hypothetical protein | - |
SAGV69_RS03080 | 582776..583120 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
SAGV69_RS03085 | 583161..583787 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 572048..581154 | 9106 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T49406 WP_001801861.1 NZ_CP009681:c579447-579352 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T49406 NZ_CP009681:c579447-579352 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT49406 NZ_CP009681:579265-579324 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|