Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1698300..1698459 | Replicon | chromosome |
Accession | NZ_CP009623 | ||
Organism | Staphylococcus agnetis strain 908 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | EP23_RS20660 | Protein ID | WP_107365594.1 |
Coordinates | 1698358..1698459 (-) | Length | 34 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1698300..1698333 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EP23_RS20635 | 1694132..1695571 | - | 1440 | WP_060551883.1 | alkaline phosphatase | - |
EP23_RS20640 | 1695790..1696440 | + | 651 | WP_060551884.1 | zinc ribbon domain-containing protein | - |
EP23_RS20645 | 1696513..1697127 | - | 615 | WP_060551885.1 | DedA family protein | - |
EP23_RS20650 | 1697245..1697655 | - | 411 | WP_060551886.1 | hypothetical protein | - |
EP23_RS20655 | 1697917..1698189 | + | 273 | WP_060551887.1 | DUF2316 family protein | - |
- | 1698300..1698333 | + | 34 | - | - | Antitoxin |
EP23_RS20660 | 1698358..1698459 | - | 102 | WP_107365594.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EP23_RS20665 | 1698594..1699604 | - | 1011 | WP_060551888.1 | HoxN/HupN/NixA family nickel/cobalt transporter | - |
EP23_RS20670 | 1699818..1700495 | + | 678 | WP_037565806.1 | response regulator transcription factor | - |
EP23_RS20675 | 1700488..1701972 | + | 1485 | WP_060551889.1 | HAMP domain-containing histidine kinase | - |
EP23_RS20680 | 1702193..1702633 | - | 441 | WP_060551890.1 | antibiotic biosynthesis monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3789.56 Da Isoelectric Point: 10.7732
>T49333 WP_107365594.1 NZ_CP009623:c1698459-1698358 [Staphylococcus agnetis]
MLDILVHITTTIISGCIVTLFAHWLRTRGNKHK
MLDILVHITTTIISGCIVTLFAHWLRTRGNKHK
Download Length: 102 bp
>T49333 NZ_CP009623:c1698459-1698358 [Staphylococcus agnetis]
ATGTTAGATATCCTTGTTCACATCACGACCACGATCATCAGTGGTTGTATTGTTACGCTTTTTGCGCATTGGCTACGCAC
GCGTGGCAATAAGCATAAATAG
ATGTTAGATATCCTTGTTCACATCACGACCACGATCATCAGTGGTTGTATTGTTACGCTTTTTGCGCATTGGCTACGCAC
GCGTGGCAATAAGCATAAATAG
Antitoxin
Download Length: 34 bp
>AT49333 NZ_CP009623:1698300-1698333 [Staphylococcus agnetis]
CACCAATCCCCTCACTACTGCCATAGTGAGGGGA
CACCAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|