Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2101370..2101669 | Replicon | chromosome |
| Accession | NZ_CP009554 | ||
| Organism | Staphylococcus aureus strain FORC_001 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | FORC1_RS15190 | Protein ID | WP_078103063.1 |
| Coordinates | 2101493..2101669 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2101370..2101425 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC1_RS10420 | 2096400..2096650 | + | 251 | Protein_1982 | sphingomyelin phosphodiesterase | - |
| FORC1_RS10425 | 2096972..2097151 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| FORC1_RS10435 | 2097462..2097722 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| FORC1_RS10440 | 2097775..2098125 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| FORC1_RS15575 | 2098636..2098974 | - | 339 | Protein_1986 | SH3 domain-containing protein | - |
| FORC1_RS10450 | 2099578..2100069 | - | 492 | WP_000920041.1 | staphylokinase | - |
| FORC1_RS10455 | 2100260..2101015 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| FORC1_RS10460 | 2101027..2101281 | - | 255 | WP_000611512.1 | phage holin | - |
| FORC1_RS10465 | 2101333..2101440 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2101362..2101501 | + | 140 | NuclAT_0 | - | - |
| - | 2101362..2101501 | + | 140 | NuclAT_0 | - | - |
| - | 2101362..2101501 | + | 140 | NuclAT_0 | - | - |
| - | 2101362..2101501 | + | 140 | NuclAT_0 | - | - |
| - | 2101370..2101425 | + | 56 | - | - | Antitoxin |
| FORC1_RS15190 | 2101493..2101669 | - | 177 | WP_078103063.1 | putative holin-like toxin | Toxin |
| FORC1_RS10475 | 2101778..2102551 | - | 774 | WP_000750407.1 | staphylococcal enterotoxin type A | - |
| FORC1_RS10480 | 2102972..2103346 | - | 375 | WP_042363643.1 | hypothetical protein | - |
| FORC1_RS10485 | 2103402..2103689 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| FORC1_RS10490 | 2103736..2103888 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / tsst-1 / groEL | 2097775..2164594 | 66819 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6873.43 Da Isoelectric Point: 10.6777
>T49271 WP_078103063.1 NZ_CP009554:c2101669-2101493 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALHKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALHKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T49271 NZ_CP009554:c2101669-2101493 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACATAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACATAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT49271 NZ_CP009554:2101370-2101425 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|