Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2181491..2181688 | Replicon | chromosome |
Accession | NZ_CP009361 | ||
Organism | Staphylococcus aureus strain ATCC 25923 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | KQ76_RS10960 | Protein ID | WP_073392962.1 |
Coordinates | 2181584..2181688 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2181491..2181529 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KQ76_RS10940 | 2177666..2178331 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
KQ76_RS10945 | 2178483..2178803 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
KQ76_RS10950 | 2178805..2179785 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
KQ76_RS10955 | 2180051..2181142 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
- | 2181491..2181529 | + | 39 | - | - | Antitoxin |
KQ76_RS10960 | 2181584..2181688 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
KQ76_RS14695 | 2182368..2182526 | + | 159 | WP_001792784.1 | hypothetical protein | - |
KQ76_RS10965 | 2183185..2184042 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
KQ76_RS10970 | 2184110..2184892 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T48802 WP_073392962.1 NZ_CP009361:c2181688-2181584 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T48802 NZ_CP009361:c2181688-2181584 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT48802 NZ_CP009361:2181491-2181529 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|