Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3693340..3693562 | Replicon | chromosome |
| Accession | NZ_CP009273 | ||
| Organism | Escherichia coli BW25113 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | BW25113_RS23010 | Protein ID | WP_000141634.1 |
| Coordinates | 3693340..3693447 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3693496..3693562 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BW25113_RS18320 (BW25113_3534) | 3688593..3689345 | - | 753 | Protein_3494 | cellulose biosynthesis protein BcsQ | - |
| BW25113_RS18325 (BW25113_3535) | 3689357..3689545 | - | 189 | WP_001063318.1 | YhjR family protein | - |
| BW25113_RS18330 (BW25113_3536) | 3689818..3691389 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
| BW25113_RS18335 (BW25113_3537) | 3691386..3691577 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| BW25113_RS18340 (BW25113_3538) | 3691574..3693253 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| BW25113_RS23010 (BW25113_4453) | 3693340..3693447 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 3693496..3693562 | + | 67 | - | - | Antitoxin |
| BW25113_RS18355 (BW25113_3539) | 3693923..3695194 | + | 1272 | WP_001295225.1 | transporter | - |
| BW25113_RS18360 (BW25113_3540) | 3695224..3696228 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BW25113_RS18365 (BW25113_3541) | 3696225..3697208 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| BW25113_RS18370 (BW25113_3542) | 3697219..3698121 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T48701 WP_000141634.1 NZ_CP009273:c3693447-3693340 [Escherichia coli BW25113]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T48701 NZ_CP009273:c3693447-3693340 [Escherichia coli BW25113]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT48701 NZ_CP009273:3693496-3693562 [Escherichia coli BW25113]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|