Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1265159..1265381 | Replicon | chromosome |
| Accession | NZ_CP009273 | ||
| Organism | Escherichia coli BW25113 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | BW25113_RS06335 | Protein ID | WP_000170963.1 |
| Coordinates | 1265159..1265266 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1265314..1265381 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BW25113_RS06305 (BW25113_1211) | 1260468..1261550 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| BW25113_RS06310 (BW25113_1212) | 1261550..1262383 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| BW25113_RS06315 (BW25113_1213) | 1262380..1262772 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| BW25113_RS06320 (BW25113_1214) | 1262776..1263585 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| BW25113_RS06325 (BW25113_1215) | 1263621..1264475 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| BW25113_RS06330 (BW25113_4419) | 1264624..1264731 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| BW25113_RS06335 (BW25113_4421) | 1265159..1265266 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
| - | 1265314..1265381 | + | 68 | - | - | Antitoxin |
| BW25113_RS06340 (BW25113_4423) | 1265694..1265801 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| BW25113_RS06345 (BW25113_1216) | 1266205..1267305 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| BW25113_RS06350 (BW25113_1217) | 1267575..1267805 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| BW25113_RS06355 (BW25113_1218) | 1267963..1268658 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| BW25113_RS06360 (BW25113_1219) | 1268702..1269055 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T48671 WP_000170963.1 NZ_CP009273:c1265266-1265159 [Escherichia coli BW25113]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T48671 NZ_CP009273:c1265266-1265159 [Escherichia coli BW25113]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT48671 NZ_CP009273:1265314-1265381 [Escherichia coli BW25113]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|