Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 4529750..4529971 | Replicon | chromosome |
Accession | NZ_CP008957 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | EDL933_RS32825 | Protein ID | WP_001295224.1 |
Coordinates | 4529750..4529857 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 4529906..4529971 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EDL933_RS23545 | 4525003..4525755 | - | 753 | Protein_4453 | cellulose biosynthesis protein BcsQ | - |
EDL933_RS23555 | 4525767..4525955 | - | 189 | WP_001063316.1 | YhjR family protein | - |
EDL933_RS23560 | 4526228..4527799 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
EDL933_RS23565 | 4527796..4527987 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
EDL933_RS23570 | 4527984..4529663 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
EDL933_RS32825 | 4529750..4529857 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4529906..4529971 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 4529906..4529971 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 4529906..4529971 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 4529906..4529971 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 4529906..4529971 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 4529906..4529971 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 4529906..4529971 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 4529906..4529971 | + | 66 | NuclAT_22 | - | Antitoxin |
EDL933_RS23585 | 4530333..4531604 | + | 1272 | WP_001301684.1 | amino acid permease | - |
EDL933_RS23590 | 4531634..4532638 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
EDL933_RS23595 | 4532635..4533618 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
EDL933_RS23600 | 4533629..4534531 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T47999 WP_001295224.1 NZ_CP008957:c4529857-4529750 [Escherichia coli O157:H7 str. EDL933]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T47999 NZ_CP008957:c4529857-4529750 [Escherichia coli O157:H7 str. EDL933]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT47999 NZ_CP008957:4529906-4529971 [Escherichia coli O157:H7 str. EDL933]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|