Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 10437..10651 | Replicon | plasmid 2 |
Accession | NZ_CP008814 | ||
Organism | Enterococcus faecalis ATCC 29212 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | DR75_RS15315 | Protein ID | WP_002360667.1 |
Coordinates | 10541..10651 (-) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 10437..10501 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DR75_RS15270 | 6190..7173 | - | 984 | WP_000007382.1 | prolipoprotein diacylglyceryl transferase | - |
DR75_RS15275 | 7217..8226 | - | 1010 | Protein_5 | replication initiator protein A | - |
DR75_RS00065 | 8698..9543 | + | 846 | WP_000239313.1 | AAA family ATPase | - |
DR75_RS00070 | 9536..9907 | + | 372 | WP_000049959.1 | replication-associated protein RepC | - |
DR75_RS00075 | 10011..10301 | - | 291 | WP_001137528.1 | hypothetical protein | - |
- | 10437..10501 | + | 65 | - | - | Antitoxin |
DR75_RS15315 | 10541..10651 | - | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DR75_RS00080 | 10799..11404 | - | 606 | WP_000238804.1 | recombinase family protein | - |
DR75_RS15320 | 11535..14504 | + | 2970 | Protein_11 | Tn3 family transposase | - |
DR75_RS00110 | 14668..14889 | - | 222 | Protein_12 | arsenical-resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..41610 | 41610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T47585 WP_002360667.1 NZ_CP008814:c10651-10541 [Enterococcus faecalis ATCC 29212]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T47585 NZ_CP008814:c10651-10541 [Enterococcus faecalis ATCC 29212]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT47585 NZ_CP008814:10437-10501 [Enterococcus faecalis ATCC 29212]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|