Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1254065..1254287 Replicon chromosome
Accession NZ_CP008801
Organism Escherichia coli KLY

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag HQ24_RS06230 Protein ID WP_000170955.1
Coordinates 1254065..1254172 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1254220..1254287 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HQ24_RS06200 1249921..1250754 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
HQ24_RS06205 1250751..1251143 + 393 WP_000200374.1 invasion regulator SirB2 -
HQ24_RS06210 1251147..1251956 + 810 WP_001257044.1 invasion regulator SirB1 -
HQ24_RS06215 1251992..1252846 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HQ24_RS06220 1252995..1253102 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1253150..1253216 + 67 NuclAT_35 - -
- 1253150..1253216 + 67 NuclAT_35 - -
- 1253150..1253216 + 67 NuclAT_35 - -
- 1253150..1253216 + 67 NuclAT_35 - -
- 1253150..1253216 + 67 NuclAT_37 - -
- 1253150..1253216 + 67 NuclAT_37 - -
- 1253150..1253216 + 67 NuclAT_37 - -
- 1253150..1253216 + 67 NuclAT_37 - -
- 1253150..1253216 + 67 NuclAT_39 - -
- 1253150..1253216 + 67 NuclAT_39 - -
- 1253150..1253216 + 67 NuclAT_39 - -
- 1253150..1253216 + 67 NuclAT_39 - -
- 1253150..1253216 + 67 NuclAT_41 - -
- 1253150..1253216 + 67 NuclAT_41 - -
- 1253150..1253216 + 67 NuclAT_41 - -
- 1253150..1253216 + 67 NuclAT_41 - -
- 1253150..1253216 + 67 NuclAT_43 - -
- 1253150..1253216 + 67 NuclAT_43 - -
- 1253150..1253216 + 67 NuclAT_43 - -
- 1253150..1253216 + 67 NuclAT_43 - -
- 1253152..1253217 + 66 NuclAT_19 - -
- 1253152..1253217 + 66 NuclAT_19 - -
- 1253152..1253217 + 66 NuclAT_19 - -
- 1253152..1253217 + 66 NuclAT_19 - -
- 1253152..1253217 + 66 NuclAT_22 - -
- 1253152..1253217 + 66 NuclAT_22 - -
- 1253152..1253217 + 66 NuclAT_22 - -
- 1253152..1253217 + 66 NuclAT_22 - -
- 1253152..1253217 + 66 NuclAT_25 - -
- 1253152..1253217 + 66 NuclAT_25 - -
- 1253152..1253217 + 66 NuclAT_25 - -
- 1253152..1253217 + 66 NuclAT_25 - -
- 1253152..1253217 + 66 NuclAT_28 - -
- 1253152..1253217 + 66 NuclAT_28 - -
- 1253152..1253217 + 66 NuclAT_28 - -
- 1253152..1253217 + 66 NuclAT_28 - -
- 1253152..1253217 + 66 NuclAT_31 - -
- 1253152..1253217 + 66 NuclAT_31 - -
- 1253152..1253217 + 66 NuclAT_31 - -
- 1253152..1253217 + 66 NuclAT_31 - -
- 1253152..1253217 + 66 NuclAT_34 - -
- 1253152..1253217 + 66 NuclAT_34 - -
- 1253152..1253217 + 66 NuclAT_34 - -
- 1253152..1253217 + 66 NuclAT_34 - -
HQ24_RS06225 1253530..1253637 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1253685..1253752 + 68 NuclAT_18 - -
- 1253685..1253752 + 68 NuclAT_18 - -
- 1253685..1253752 + 68 NuclAT_18 - -
- 1253685..1253752 + 68 NuclAT_18 - -
- 1253685..1253752 + 68 NuclAT_21 - -
- 1253685..1253752 + 68 NuclAT_21 - -
- 1253685..1253752 + 68 NuclAT_21 - -
- 1253685..1253752 + 68 NuclAT_21 - -
- 1253685..1253752 + 68 NuclAT_24 - -
- 1253685..1253752 + 68 NuclAT_24 - -
- 1253685..1253752 + 68 NuclAT_24 - -
- 1253685..1253752 + 68 NuclAT_24 - -
- 1253685..1253752 + 68 NuclAT_27 - -
- 1253685..1253752 + 68 NuclAT_27 - -
- 1253685..1253752 + 68 NuclAT_27 - -
- 1253685..1253752 + 68 NuclAT_27 - -
- 1253685..1253752 + 68 NuclAT_30 - -
- 1253685..1253752 + 68 NuclAT_30 - -
- 1253685..1253752 + 68 NuclAT_30 - -
- 1253685..1253752 + 68 NuclAT_30 - -
- 1253685..1253752 + 68 NuclAT_33 - -
- 1253685..1253752 + 68 NuclAT_33 - -
- 1253685..1253752 + 68 NuclAT_33 - -
- 1253685..1253752 + 68 NuclAT_33 - -
- 1253686..1253751 + 66 NuclAT_36 - -
- 1253686..1253751 + 66 NuclAT_36 - -
- 1253686..1253751 + 66 NuclAT_36 - -
- 1253686..1253751 + 66 NuclAT_36 - -
- 1253686..1253751 + 66 NuclAT_38 - -
- 1253686..1253751 + 66 NuclAT_38 - -
- 1253686..1253751 + 66 NuclAT_38 - -
- 1253686..1253751 + 66 NuclAT_38 - -
- 1253686..1253751 + 66 NuclAT_40 - -
- 1253686..1253751 + 66 NuclAT_40 - -
- 1253686..1253751 + 66 NuclAT_40 - -
- 1253686..1253751 + 66 NuclAT_40 - -
- 1253686..1253751 + 66 NuclAT_42 - -
- 1253686..1253751 + 66 NuclAT_42 - -
- 1253686..1253751 + 66 NuclAT_42 - -
- 1253686..1253751 + 66 NuclAT_42 - -
- 1253686..1253751 + 66 NuclAT_44 - -
- 1253686..1253751 + 66 NuclAT_44 - -
- 1253686..1253751 + 66 NuclAT_44 - -
- 1253686..1253751 + 66 NuclAT_44 - -
HQ24_RS06230 1254065..1254172 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1254220..1254287 + 68 NuclAT_17 - Antitoxin
- 1254220..1254287 + 68 NuclAT_17 - Antitoxin
- 1254220..1254287 + 68 NuclAT_17 - Antitoxin
- 1254220..1254287 + 68 NuclAT_17 - Antitoxin
- 1254220..1254287 + 68 NuclAT_20 - Antitoxin
- 1254220..1254287 + 68 NuclAT_20 - Antitoxin
- 1254220..1254287 + 68 NuclAT_20 - Antitoxin
- 1254220..1254287 + 68 NuclAT_20 - Antitoxin
- 1254220..1254287 + 68 NuclAT_23 - Antitoxin
- 1254220..1254287 + 68 NuclAT_23 - Antitoxin
- 1254220..1254287 + 68 NuclAT_23 - Antitoxin
- 1254220..1254287 + 68 NuclAT_23 - Antitoxin
- 1254220..1254287 + 68 NuclAT_26 - Antitoxin
- 1254220..1254287 + 68 NuclAT_26 - Antitoxin
- 1254220..1254287 + 68 NuclAT_26 - Antitoxin
- 1254220..1254287 + 68 NuclAT_26 - Antitoxin
- 1254220..1254287 + 68 NuclAT_29 - Antitoxin
- 1254220..1254287 + 68 NuclAT_29 - Antitoxin
- 1254220..1254287 + 68 NuclAT_29 - Antitoxin
- 1254220..1254287 + 68 NuclAT_29 - Antitoxin
- 1254220..1254287 + 68 NuclAT_32 - Antitoxin
- 1254220..1254287 + 68 NuclAT_32 - Antitoxin
- 1254220..1254287 + 68 NuclAT_32 - Antitoxin
- 1254220..1254287 + 68 NuclAT_32 - Antitoxin
HQ24_RS06235 1254576..1255676 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
HQ24_RS06240 1255946..1256176 + 231 WP_001146444.1 putative cation transport regulator ChaB -
HQ24_RS06245 1256334..1257029 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
HQ24_RS06250 1257073..1257426 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
HQ24_RS06255 1257611..1259005 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T47494 WP_000170955.1 NZ_CP008801:c1254172-1254065 [Escherichia coli KLY]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T47494 NZ_CP008801:c1254172-1254065 [Escherichia coli KLY]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT47494 NZ_CP008801:1254220-1254287 [Escherichia coli KLY]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References