Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2646321..2646482 | Replicon | chromosome |
| Accession | NZ_CP008724 | ||
| Organism | Staphylococcus xylosus strain SMQ-121 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SXYLSMQ121_RS13045 | Protein ID | WP_002441941.1 |
| Coordinates | 2646387..2646482 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2646321..2646358 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SXYLSMQ121_RS12325 | 2641342..2641806 | + | 465 | WP_042363441.1 | hypothetical protein | - |
| SXYLSMQ121_RS12330 | 2642006..2642314 | - | 309 | WP_107543257.1 | hypothetical protein | - |
| SXYLSMQ121_RS12335 | 2642477..2643169 | + | 693 | WP_171031833.1 | hypothetical protein | - |
| SXYLSMQ121_RS13040 | 2643355..2643441 | - | 87 | WP_107539440.1 | type I toxin-antitoxin system Fst family toxin | - |
| SXYLSMQ121_RS12340 | 2643777..2644739 | - | 963 | WP_042363443.1 | nitronate monooxygenase | - |
| SXYLSMQ121_RS12345 | 2644864..2645235 | + | 372 | WP_042363444.1 | helix-turn-helix transcriptional regulator | - |
| SXYLSMQ121_RS12350 | 2645409..2646134 | + | 726 | WP_042363445.1 | NAD(P)-binding domain-containing protein | - |
| - | 2646321..2646358 | + | 38 | NuclAT_2 | - | Antitoxin |
| SXYLSMQ121_RS13045 | 2646387..2646482 | - | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SXYLSMQ121_RS12355 | 2646617..2647792 | - | 1176 | WP_042363446.1 | ABC transporter permease | - |
| SXYLSMQ121_RS12360 | 2647789..2648469 | - | 681 | WP_042363447.1 | ABC transporter ATP-binding protein | - |
| SXYLSMQ121_RS12365 | 2648466..2649581 | - | 1116 | WP_042363448.1 | RND transporter | - |
| SXYLSMQ121_RS12370 | 2650002..2651375 | + | 1374 | WP_052344191.1 | YfcC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T47297 WP_002441941.1 NZ_CP008724:c2646482-2646387 [Staphylococcus xylosus]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T47297 NZ_CP008724:c2646482-2646387 [Staphylococcus xylosus]
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTACTTTACTTACTGGCTTAGTAG
TAAACGCAATAAATAG
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTACTTTACTTACTGGCTTAGTAG
TAAACGCAATAAATAG
Antitoxin
Download Length: 38 bp
>AT47297 NZ_CP008724:2646321-2646358 [Staphylococcus xylosus]
TATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
TATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|