Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 69703..69942 | Replicon | plasmid pEC648_1 |
Accession | NZ_CP008715 | ||
Organism | Escherichia coli strain ST648 isolate Pleural Effusion of Patients with Empyema Thoracis |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | FH07_RS25355 | Protein ID | WP_023144756.1 |
Coordinates | 69808..69942 (+) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 69703..69763 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FH07_RS25335 | 67232..67978 | + | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
FH07_RS25340 | 68033..68593 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
FH07_RS25345 | 68725..68937 | + | 213 | WP_013023861.1 | hypothetical protein | - |
FH07_RS25350 | 69450..69736 | + | 287 | Protein_76 | DUF2726 domain-containing protein | - |
- | 69703..69763 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 69703..69763 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 69703..69763 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 69703..69763 | - | 61 | NuclAT_0 | - | Antitoxin |
FH07_RS25355 | 69808..69942 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FH07_RS27335 | 70239..70349 | + | 111 | Protein_78 | replication protein | - |
FH07_RS25360 | 70418..71200 | - | 783 | WP_001300609.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
FH07_RS25365 | 71197..72219 | - | 1023 | WP_000255944.1 | IS21-like element IS100 family transposase | - |
FH07_RS27340 | 72300..72452 | + | 153 | WP_072258247.1 | replication protein A | - |
FH07_RS29035 | 72558..72692 | + | 135 | Protein_82 | protein CopA/IncA | - |
FH07_RS25370 | 72689..72763 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
FH07_RS25375 | 72756..73613 | + | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD / blaTEM-1B / aadA5 / qacE / sul1 / mph(A) / tet(B) | iucA / iucB / iucC / iucD / iutA | 1..120653 | 120653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T47288 WP_023144756.1 NZ_CP008715:69808-69942 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T47288 NZ_CP008715:69808-69942 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT47288 NZ_CP008715:c69763-69703 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|