Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2090855..2091154 | Replicon | chromosome |
Accession | NZ_CP007690 | ||
Organism | Staphylococcus aureus strain UA-S391_USA300 isolate abscess/wound isolate |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EX97_RS15275 | Protein ID | WP_011447039.1 |
Coordinates | 2090978..2091154 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2090855..2090910 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EX97_RS10535 | 2086186..2086446 | + | 261 | WP_001791826.1 | hypothetical protein | - |
EX97_RS10540 | 2086499..2086849 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
EX97_RS10545 | 2087534..2087983 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
EX97_RS15590 | 2088078..2088413 | - | 336 | Protein_2002 | SH3 domain-containing protein | - |
EX97_RS10555 | 2089063..2089554 | - | 492 | WP_000919350.1 | staphylokinase | - |
EX97_RS10560 | 2089745..2090500 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EX97_RS10565 | 2090512..2090766 | - | 255 | WP_000611512.1 | phage holin | - |
EX97_RS10570 | 2090818..2090925 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2090847..2090986 | + | 140 | NuclAT_0 | - | - |
- | 2090847..2090986 | + | 140 | NuclAT_0 | - | - |
- | 2090847..2090986 | + | 140 | NuclAT_0 | - | - |
- | 2090847..2090986 | + | 140 | NuclAT_0 | - | - |
- | 2090855..2090910 | + | 56 | - | - | Antitoxin |
EX97_RS15275 | 2090978..2091154 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EX97_RS10580 | 2091304..2091600 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
EX97_RS10585 | 2091658..2091945 | - | 288 | WP_001040261.1 | hypothetical protein | - |
EX97_RS10590 | 2091992..2092144 | - | 153 | WP_001153681.1 | hypothetical protein | - |
EX97_RS10595 | 2092134..2095919 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | map / scn / chp / sak / hlb / groEL | 2082682..2145465 | 62783 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T46892 WP_011447039.1 NZ_CP007690:c2091154-2090978 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T46892 NZ_CP007690:c2091154-2090978 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46892 NZ_CP007690:2090855-2090910 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|