Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1929864..1930046 | Replicon | chromosome |
Accession | NZ_CP007690 | ||
Organism | Staphylococcus aureus strain UA-S391_USA300 isolate abscess/wound isolate |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EX97_RS15570 | Protein ID | WP_001801861.1 |
Coordinates | 1929864..1929959 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1929987..1930046 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EX97_RS09545 | 1925524..1926150 | + | 627 | Protein_1841 | hypothetical protein | - |
EX97_RS09550 | 1926191..1926535 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
EX97_RS09555 | 1926633..1927184 | + | 552 | WP_000414205.1 | hypothetical protein | - |
EX97_RS09560 | 1927402..1928043 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
EX97_RS09565 | 1928157..1928342 | - | 186 | WP_000809857.1 | hypothetical protein | - |
EX97_RS09570 | 1928344..1928520 | - | 177 | WP_000375476.1 | hypothetical protein | - |
EX97_RS09575 | 1928531..1928914 | - | 384 | WP_000070811.1 | hypothetical protein | - |
EX97_RS09585 | 1929518..1929661 | - | 144 | WP_001549059.1 | transposase | - |
EX97_RS15570 | 1929864..1929959 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1929987..1930046 | - | 60 | - | - | Antitoxin |
EX97_RS09590 | 1930082..1930183 | + | 102 | WP_001791893.1 | hypothetical protein | - |
EX97_RS15200 | 1930161..1930337 | - | 177 | Protein_1851 | transposase | - |
EX97_RS09595 | 1930531..1930908 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1922964..1948566 | 25602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46889 WP_001801861.1 NZ_CP007690:1929864-1929959 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46889 NZ_CP007690:1929864-1929959 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT46889 NZ_CP007690:c1930046-1929987 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|