Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2524901..2525085 | Replicon | chromosome |
Accession | NZ_CP007676 | ||
Organism | Staphylococcus aureus strain HUV05 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | ER12_RS12985 | Protein ID | WP_000482650.1 |
Coordinates | 2524978..2525085 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2524901..2524961 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ER12_RS12960 | 2520431..2520598 | - | 168 | WP_001790576.1 | hypothetical protein | - |
ER12_RS12970 | 2520829..2522562 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
ER12_RS12975 | 2522587..2524350 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 2524901..2524961 | + | 61 | - | - | Antitoxin |
ER12_RS12985 | 2524978..2525085 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ER12_RS12990 | 2525219..2525605 | - | 387 | WP_000779358.1 | flippase GtxA | - |
ER12_RS12995 | 2525873..2527015 | + | 1143 | WP_047212331.1 | glycerate kinase | - |
ER12_RS13000 | 2527075..2527734 | + | 660 | WP_000831298.1 | membrane protein | - |
ER12_RS13005 | 2527916..2529127 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
ER12_RS13010 | 2529250..2529723 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T46883 WP_000482650.1 NZ_CP007676:c2525085-2524978 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T46883 NZ_CP007676:c2525085-2524978 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT46883 NZ_CP007676:2524901-2524961 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|