Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2060244..2060543 | Replicon | chromosome |
Accession | NZ_CP007676 | ||
Organism | Staphylococcus aureus strain HUV05 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | ER12_RS15390 | Protein ID | WP_011447039.1 |
Coordinates | 2060367..2060543 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2060244..2060299 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ER12_RS10375 | 2055575..2055835 | + | 261 | WP_001791826.1 | hypothetical protein | - |
ER12_RS10380 | 2055888..2056238 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
ER12_RS10385 | 2056923..2057372 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
ER12_RS15805 | 2057467..2057802 | - | 336 | Protein_1962 | SH3 domain-containing protein | - |
ER12_RS10395 | 2058452..2058943 | - | 492 | WP_000919350.1 | staphylokinase | - |
ER12_RS10400 | 2059134..2059889 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
ER12_RS10405 | 2059901..2060155 | - | 255 | WP_000611512.1 | phage holin | - |
ER12_RS10410 | 2060207..2060314 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2060236..2060375 | + | 140 | NuclAT_0 | - | - |
- | 2060236..2060375 | + | 140 | NuclAT_0 | - | - |
- | 2060236..2060375 | + | 140 | NuclAT_0 | - | - |
- | 2060236..2060375 | + | 140 | NuclAT_0 | - | - |
- | 2060244..2060299 | + | 56 | - | - | Antitoxin |
ER12_RS15390 | 2060367..2060543 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
ER12_RS10415 | 2060693..2060989 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
ER12_RS10420 | 2061047..2061334 | - | 288 | WP_001040261.1 | hypothetical protein | - |
ER12_RS10425 | 2061381..2061533 | - | 153 | WP_001153681.1 | hypothetical protein | - |
ER12_RS10430 | 2061523..2065308 | - | 3786 | WP_048520783.1 | phage minor structural protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2055888..2114855 | 58967 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T46874 WP_011447039.1 NZ_CP007676:c2060543-2060367 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T46874 NZ_CP007676:c2060543-2060367 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46874 NZ_CP007676:2060244-2060299 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|