Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1901058..1901240 | Replicon | chromosome |
Accession | NZ_CP007676 | ||
Organism | Staphylococcus aureus strain HUV05 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ER12_RS15785 | Protein ID | WP_001801861.1 |
Coordinates | 1901058..1901153 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1901181..1901240 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ER12_RS09395 | 1896718..1897344 | + | 627 | WP_000669046.1 | hypothetical protein | - |
ER12_RS09400 | 1897385..1897729 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
ER12_RS09405 | 1897827..1898378 | + | 552 | WP_000414205.1 | hypothetical protein | - |
ER12_RS09410 | 1898596..1899237 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
ER12_RS09415 | 1899351..1899536 | - | 186 | WP_000809857.1 | hypothetical protein | - |
ER12_RS09420 | 1899538..1899714 | - | 177 | WP_000375476.1 | hypothetical protein | - |
ER12_RS09425 | 1899725..1900108 | - | 384 | WP_000070811.1 | hypothetical protein | - |
ER12_RS09435 | 1900712..1900855 | - | 144 | WP_001549059.1 | transposase | - |
ER12_RS15785 | 1901058..1901153 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1901181..1901240 | - | 60 | - | - | Antitoxin |
ER12_RS09440 | 1901276..1901377 | + | 102 | WP_001791893.1 | hypothetical protein | - |
ER12_RS15315 | 1901355..1901531 | - | 177 | Protein_1813 | transposase | - |
ER12_RS09445 | 1901725..1902102 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1894158..1918016 | 23858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46871 WP_001801861.1 NZ_CP007676:1901058-1901153 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46871 NZ_CP007676:1901058-1901153 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT46871 NZ_CP007676:c1901240-1901181 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|