Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2230969..2231186 | Replicon | chromosome |
Accession | NZ_CP007674 | ||
Organism | Staphylococcus aureus strain CA15 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | EQ90_RS16050 | Protein ID | WP_001802298.1 |
Coordinates | 2231082..2231186 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2230969..2231024 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQ90_RS11385 | 2227106..2227771 | - | 666 | WP_047339388.1 | SDR family oxidoreductase | - |
EQ90_RS11390 | 2227923..2228243 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
EQ90_RS11395 | 2228245..2229225 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
EQ90_RS11400 | 2229491..2230582 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2230969..2231024 | + | 56 | - | - | Antitoxin |
EQ90_RS16050 | 2231082..2231186 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
EQ90_RS16620 | 2231347..2231830 | - | 484 | Protein_2160 | recombinase family protein | - |
EQ90_RS11415 | 2231873..2233009 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
EQ90_RS16055 | 2233298..2233390 | + | 93 | WP_001790138.1 | hypothetical protein | - |
EQ90_RS11425 | 2234095..2234952 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
EQ90_RS11430 | 2235020..2235802 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T46865 WP_001802298.1 NZ_CP007674:c2231186-2231082 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T46865 NZ_CP007674:c2231186-2231082 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46865 NZ_CP007674:2230969-2231024 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|