Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2056300..2056599 | Replicon | chromosome |
Accession | NZ_CP007674 | ||
Organism | Staphylococcus aureus strain CA15 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EQ90_RS15940 | Protein ID | WP_011447039.1 |
Coordinates | 2056423..2056599 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2056300..2056355 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQ90_RS15915 | 2051631..2051891 | + | 261 | WP_001791826.1 | hypothetical protein | - |
EQ90_RS10355 | 2051944..2052294 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
EQ90_RS10360 | 2052979..2053428 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
EQ90_RS16615 | 2053523..2053858 | - | 336 | Protein_1961 | SH3 domain-containing protein | - |
EQ90_RS10370 | 2054508..2054999 | - | 492 | WP_000919350.1 | staphylokinase | - |
EQ90_RS10375 | 2055190..2055945 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EQ90_RS10380 | 2055957..2056211 | - | 255 | WP_000611512.1 | phage holin | - |
EQ90_RS15935 | 2056263..2056370 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2056292..2056431 | + | 140 | NuclAT_0 | - | - |
- | 2056292..2056431 | + | 140 | NuclAT_0 | - | - |
- | 2056292..2056431 | + | 140 | NuclAT_0 | - | - |
- | 2056292..2056431 | + | 140 | NuclAT_0 | - | - |
- | 2056300..2056355 | + | 56 | - | - | Antitoxin |
EQ90_RS15940 | 2056423..2056599 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EQ90_RS10395 | 2056749..2057045 | - | 297 | WP_047339384.1 | DUF2951 domain-containing protein | - |
EQ90_RS10400 | 2057103..2057390 | - | 288 | WP_001040261.1 | hypothetical protein | - |
EQ90_RS15945 | 2057437..2057589 | - | 153 | WP_001153681.1 | hypothetical protein | - |
EQ90_RS10410 | 2057579..2061364 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2051944..2107893 | 55949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T46858 WP_011447039.1 NZ_CP007674:c2056599-2056423 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T46858 NZ_CP007674:c2056599-2056423 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46858 NZ_CP007674:2056300-2056355 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|