Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1895457..1895639 | Replicon | chromosome |
Accession | NZ_CP007674 | ||
Organism | Staphylococcus aureus strain CA15 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EQ90_RS16595 | Protein ID | WP_001801861.1 |
Coordinates | 1895457..1895552 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1895580..1895639 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQ90_RS09360 | 1891117..1891743 | + | 627 | WP_000669046.1 | hypothetical protein | - |
EQ90_RS09365 | 1891784..1892128 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
EQ90_RS09370 | 1892226..1892777 | + | 552 | WP_000414205.1 | hypothetical protein | - |
EQ90_RS09375 | 1892995..1893636 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
EQ90_RS09380 | 1893750..1893935 | - | 186 | WP_000809857.1 | hypothetical protein | - |
EQ90_RS15745 | 1893937..1894113 | - | 177 | WP_000375476.1 | hypothetical protein | - |
EQ90_RS09390 | 1894124..1894507 | - | 384 | WP_000070811.1 | hypothetical protein | - |
EQ90_RS15755 | 1895111..1895254 | - | 144 | WP_001549059.1 | transposase | - |
EQ90_RS16595 | 1895457..1895552 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1895580..1895639 | - | 60 | - | - | Antitoxin |
EQ90_RS15760 | 1895675..1895776 | + | 102 | WP_001791893.1 | hypothetical protein | - |
EQ90_RS15765 | 1895754..1895930 | - | 177 | Protein_1809 | transposase | - |
EQ90_RS09410 | 1896124..1896501 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1858017..1976303 | 118286 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46855 WP_001801861.1 NZ_CP007674:1895457-1895552 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46855 NZ_CP007674:1895457-1895552 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT46855 NZ_CP007674:c1895639-1895580 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|