Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1898585..1898767 | Replicon | chromosome |
| Accession | NZ_CP007672 | ||
| Organism | Staphylococcus aureus strain CA12 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EQ80_RS15465 | Protein ID | WP_001801861.1 |
| Coordinates | 1898585..1898680 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1898708..1898767 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQ80_RS09390 | 1894245..1894871 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| EQ80_RS09395 | 1894912..1895256 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| EQ80_RS09400 | 1895354..1895905 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| EQ80_RS09405 | 1896123..1896764 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EQ80_RS09410 | 1896878..1897063 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| EQ80_RS09415 | 1897065..1897241 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| EQ80_RS09420 | 1897252..1897635 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| EQ80_RS09430 | 1898239..1898382 | - | 144 | WP_001549059.1 | transposase | - |
| EQ80_RS15465 | 1898585..1898680 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1898708..1898767 | - | 60 | - | - | Antitoxin |
| EQ80_RS09435 | 1898803..1898904 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| EQ80_RS15085 | 1898882..1899058 | - | 177 | Protein_1808 | transposase | - |
| EQ80_RS09440 | 1899252..1899629 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1891685..1918683 | 26998 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46839 WP_001801861.1 NZ_CP007672:1898585-1898680 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46839 NZ_CP007672:1898585-1898680 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT46839 NZ_CP007672:c1898767-1898708 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|