Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2115534..2115833 | Replicon | chromosome |
Accession | NZ_CP007670 | ||
Organism | Staphylococcus aureus strain M121 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EP54_RS16350 | Protein ID | WP_011447039.1 |
Coordinates | 2115657..2115833 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2115534..2115589 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EP54_RS16325 | 2110865..2111125 | + | 261 | WP_001791826.1 | hypothetical protein | - |
EP54_RS10815 | 2111178..2111528 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
EP54_RS10820 | 2112213..2112662 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
EP54_RS17035 | 2112757..2113092 | - | 336 | Protein_2047 | SH3 domain-containing protein | - |
EP54_RS10830 | 2113742..2114233 | - | 492 | Protein_2048 | staphylokinase | - |
EP54_RS10835 | 2114424..2115179 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EP54_RS10840 | 2115191..2115445 | - | 255 | WP_000611512.1 | phage holin | - |
EP54_RS16345 | 2115497..2115604 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2115526..2115665 | + | 140 | NuclAT_0 | - | - |
- | 2115526..2115665 | + | 140 | NuclAT_0 | - | - |
- | 2115526..2115665 | + | 140 | NuclAT_0 | - | - |
- | 2115526..2115665 | + | 140 | NuclAT_0 | - | - |
- | 2115534..2115589 | + | 56 | - | - | Antitoxin |
EP54_RS16350 | 2115657..2115833 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EP54_RS10855 | 2115983..2116279 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
EP54_RS10860 | 2116337..2116624 | - | 288 | WP_001040261.1 | hypothetical protein | - |
EP54_RS16355 | 2116671..2116823 | - | 153 | WP_001153681.1 | hypothetical protein | - |
EP54_RS10870 | 2116813..2120598 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / sak / hlb / groEL | 2111178..2167125 | 55947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T46826 WP_011447039.1 NZ_CP007670:c2115833-2115657 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T46826 NZ_CP007670:c2115833-2115657 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46826 NZ_CP007670:2115534-2115589 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|