Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2242036..2242253 | Replicon | chromosome |
Accession | NZ_CP007659 | ||
Organism | Staphylococcus aureus strain H-EMRSA-15 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | ER16_RS11380 | Protein ID | WP_075583739.1 |
Coordinates | 2242149..2242253 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2242036..2242091 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ER16_RS11360 | 2238092..2238757 | - | 666 | WP_001024097.1 | SDR family oxidoreductase | - |
ER16_RS11365 | 2238909..2239229 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
ER16_RS11370 | 2239231..2240211 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
ER16_RS11375 | 2240477..2241568 | + | 1092 | WP_000495678.1 | hypothetical protein | - |
- | 2242036..2242091 | + | 56 | - | - | Antitoxin |
ER16_RS11380 | 2242149..2242253 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
ER16_RS15005 | 2242351..2242512 | - | 162 | Protein_2153 | helix-turn-helix domain-containing protein | - |
ER16_RS15340 | 2242930..2243088 | + | 159 | WP_024928151.1 | hypothetical protein | - |
ER16_RS11390 | 2243748..2244605 | - | 858 | WP_000370944.1 | Cof-type HAD-IIB family hydrolase | - |
ER16_RS11395 | 2244673..2245455 | - | 783 | WP_000908181.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T46809 WP_075583739.1 NZ_CP007659:c2242253-2242149 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
>T46809 NZ_CP007659:c2242253-2242149 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46809 NZ_CP007659:2242036-2242091 [Staphylococcus aureus]
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|