Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF2/- |
Location | 2062512..2062811 | Replicon | chromosome |
Accession | NZ_CP007659 | ||
Organism | Staphylococcus aureus strain H-EMRSA-15 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | ER16_RS14950 | Protein ID | WP_011447039.1 |
Coordinates | 2062635..2062811 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2062512..2062567 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ER16_RS10315 | 2057843..2058103 | + | 261 | WP_001791826.1 | hypothetical protein | - |
ER16_RS10320 | 2058156..2058506 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
ER16_RS10325 | 2059191..2059640 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
ER16_RS15330 | 2059735..2060070 | - | 336 | Protein_1948 | SH3 domain-containing protein | - |
ER16_RS10335 | 2060720..2061211 | - | 492 | WP_000919349.1 | staphylokinase | - |
ER16_RS10340 | 2061402..2062157 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
ER16_RS10345 | 2062169..2062423 | - | 255 | WP_000611512.1 | phage holin | - |
ER16_RS14945 | 2062475..2062582 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2062504..2062643 | + | 140 | NuclAT_1 | - | - |
- | 2062504..2062643 | + | 140 | NuclAT_1 | - | - |
- | 2062504..2062643 | + | 140 | NuclAT_1 | - | - |
- | 2062504..2062643 | + | 140 | NuclAT_1 | - | - |
- | 2062512..2062567 | + | 56 | - | - | Antitoxin |
ER16_RS14950 | 2062635..2062811 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
ER16_RS10355 | 2062961..2063257 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
ER16_RS10360 | 2063315..2063602 | - | 288 | WP_001040261.1 | hypothetical protein | - |
ER16_RS10365 | 2063649..2063801 | - | 153 | WP_001153681.1 | hypothetical protein | - |
ER16_RS10370 | 2063791..2067576 | - | 3786 | WP_000582168.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2058156..2116076 | 57920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T46806 WP_011447039.1 NZ_CP007659:c2062811-2062635 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T46806 NZ_CP007659:c2062811-2062635 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46806 NZ_CP007659:2062512-2062567 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|