Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1909644..1909824 | Replicon | chromosome |
Accession | NZ_CP007659 | ||
Organism | Staphylococcus aureus strain H-EMRSA-15 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ER16_RS15305 | Protein ID | WP_001801861.1 |
Coordinates | 1909644..1909739 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1909767..1909824 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ER16_RS09340 | 1904931..1905698 | - | 768 | WP_001095317.1 | IS21-like element helper ATPase IstB | - |
ER16_RS09345 | 1905710..1906945 | - | 1236 | WP_001215400.1 | IS21 family transposase | - |
ER16_RS09350 | 1907303..1907872 | - | 570 | WP_000864144.1 | ImmA/IrrE family metallo-endopeptidase | - |
ER16_RS09360 | 1908245..1908421 | - | 177 | WP_000375476.1 | hypothetical protein | - |
ER16_RS09365 | 1908432..1908815 | - | 384 | WP_000070809.1 | hypothetical protein | - |
ER16_RS14880 | 1909395..1909499 | - | 105 | WP_001670380.1 | transposase | - |
ER16_RS15305 | 1909644..1909739 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1909767..1909824 | - | 58 | - | - | Antitoxin |
ER16_RS09375 | 1909862..1909963 | + | 102 | WP_001791232.1 | hypothetical protein | - |
ER16_RS15310 | 1909941..1910113 | - | 173 | Protein_1802 | transposase | - |
ER16_RS09380 | 1910307..1910684 | - | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
ER16_RS09385 | 1910890..1911330 | - | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
ER16_RS09390 | 1911375..1912988 | + | 1614 | WP_000926708.1 | lipase | - |
ER16_RS09395 | 1913003..1913302 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
ER16_RS09400 | 1913619..1914800 | - | 1182 | WP_000162901.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 1900664..1926054 | 25390 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46802 WP_001801861.1 NZ_CP007659:1909644-1909739 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46802 NZ_CP007659:1909644-1909739 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT46802 NZ_CP007659:c1909824-1909767 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|