Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1538920..1539219 | Replicon | chromosome |
Accession | NZ_CP007659 | ||
Organism | Staphylococcus aureus strain H-EMRSA-15 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | ER16_RS14815 | Protein ID | WP_011447039.1 |
Coordinates | 1539043..1539219 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1538920..1538975 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ER16_RS15425 | 1534154..1534369 | - | 216 | WP_170267452.1 | hypothetical protein | - |
ER16_RS07380 | 1534548..1535558 | - | 1011 | WP_000777019.1 | restriction endonuclease subunit S | - |
ER16_RS07385 | 1535545..1537449 | - | 1905 | WP_001003363.1 | N-6 DNA methylase | - |
ER16_RS07395 | 1537810..1538565 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
ER16_RS07400 | 1538577..1538831 | - | 255 | WP_000611512.1 | phage holin | - |
ER16_RS07405 | 1538883..1538990 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1538912..1539051 | + | 140 | NuclAT_0 | - | - |
- | 1538912..1539051 | + | 140 | NuclAT_0 | - | - |
- | 1538912..1539051 | + | 140 | NuclAT_0 | - | - |
- | 1538912..1539051 | + | 140 | NuclAT_0 | - | - |
- | 1538920..1538975 | + | 56 | - | - | Antitoxin |
ER16_RS14815 | 1539043..1539219 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
ER16_RS07415 | 1539372..1539671 | - | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
ER16_RS07420 | 1539717..1539881 | - | 165 | WP_000916020.1 | XkdX family protein | - |
ER16_RS07425 | 1539874..1540263 | - | 390 | WP_001166596.1 | DUF2977 domain-containing protein | - |
ER16_RS07430 | 1540263..1541729 | - | 1467 | WP_000067127.1 | BppU family phage baseplate upper protein | - |
ER16_RS07435 | 1541729..1543639 | - | 1911 | WP_000429558.1 | minor structural protein | - |
ER16_RS07440 | 1543655..1543945 | - | 291 | WP_000179858.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1534154..1600263 | 66109 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T46797 WP_011447039.1 NZ_CP007659:c1539219-1539043 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T46797 NZ_CP007659:c1539219-1539043 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGGTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGGTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46797 NZ_CP007659:1538920-1538975 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|