Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1141955..1142117 | Replicon | chromosome |
Accession | NZ_CP007601 | ||
Organism | Staphylococcus capitis subsp. capitis strain AYP1020 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A507SQ11 |
Locus tag | ayp1020_RS05335 | Protein ID | WP_030063529.1 |
Coordinates | 1142013..1142117 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1141955..1141985 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ayp1020_RS05310 | 1138146..1138886 | - | 741 | WP_047796431.1 | ABC transporter ATP-binding protein | - |
ayp1020_RS05315 | 1139019..1139444 | + | 426 | WP_047796432.1 | HIT family protein | - |
ayp1020_RS05320 | 1139522..1139893 | + | 372 | WP_002434824.1 | YtxH domain-containing protein | - |
ayp1020_RS05325 | 1140085..1140654 | + | 570 | WP_002434864.1 | DUF3267 domain-containing protein | - |
ayp1020_RS05330 | 1140857..1141858 | + | 1002 | WP_023350053.1 | peptidylprolyl isomerase | - |
- | 1141955..1141985 | - | 31 | - | - | Antitoxin |
ayp1020_RS05335 | 1142013..1142117 | - | 105 | WP_030063529.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ayp1020_RS05340 | 1142308..1143249 | - | 942 | WP_002434737.1 | 3'-5' exoribonuclease YhaM | - |
ayp1020_RS05345 | 1143246..1146185 | - | 2940 | WP_047796433.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3963.74 Da Isoelectric Point: 10.7588
>T46720 WP_030063529.1 NZ_CP007601:c1142117-1142013 [Staphylococcus capitis subsp. capitis]
MLFDIFVHIMATATSGCIVALFAHWLRTRNDKRK
MLFDIFVHIMATATSGCIVALFAHWLRTRNDKRK
Download Length: 105 bp
>T46720 NZ_CP007601:c1142117-1142013 [Staphylococcus capitis subsp. capitis]
ATGTTATTTGATATCTTTGTACACATCATGGCCACGGCAACCAGTGGTTGTATCGTTGCTTTATTCGCGCATTGGCTACG
CACTCGCAACGATAAACGTAAATAG
ATGTTATTTGATATCTTTGTACACATCATGGCCACGGCAACCAGTGGTTGTATCGTTGCTTTATTCGCGCATTGGCTACG
CACTCGCAACGATAAACGTAAATAG
Antitoxin
Download Length: 31 bp
>AT46720 NZ_CP007601:c1141985-1141955 [Staphylococcus capitis subsp. capitis]
AAATCCCCTCACTACTGCCATAGTGAGGGGA
AAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|