Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2348210..2348427 | Replicon | chromosome |
Accession | NZ_CP007499 | ||
Organism | Staphylococcus aureus strain 2395 USA500 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | CH51_RS12190 | Protein ID | WP_001802298.1 |
Coordinates | 2348323..2348427 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2348210..2348265 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CH51_RS12170 | 2344347..2345012 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
CH51_RS12175 | 2345164..2345484 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
CH51_RS12180 | 2345486..2346466 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
CH51_RS12185 | 2346732..2347823 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2348210..2348265 | + | 56 | - | - | Antitoxin |
CH51_RS12190 | 2348323..2348427 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
CH51_RS16490 | 2348588..2349071 | - | 484 | Protein_2313 | recombinase family protein | - |
CH51_RS12200 | 2349114..2350250 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
CH51_RS12205 | 2350539..2350631 | + | 93 | WP_001790138.1 | hypothetical protein | - |
CH51_RS12210 | 2351336..2352193 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
CH51_RS12215 | 2352261..2353043 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T46555 WP_001802298.1 NZ_CP007499:c2348427-2348323 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T46555 NZ_CP007499:c2348427-2348323 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46555 NZ_CP007499:2348210-2348265 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|