Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2010552..2010734 | Replicon | chromosome |
Accession | NZ_CP007499 | ||
Organism | Staphylococcus aureus strain 2395 USA500 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CH51_RS16455 | Protein ID | WP_001801861.1 |
Coordinates | 2010552..2010647 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2010675..2010734 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CH51_RS10090 | 2006212..2006838 | + | 627 | WP_000669046.1 | hypothetical protein | - |
CH51_RS10095 | 2006879..2007223 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
CH51_RS10100 | 2007321..2007872 | + | 552 | WP_000414205.1 | hypothetical protein | - |
CH51_RS10105 | 2008090..2008731 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
CH51_RS10110 | 2008845..2009030 | - | 186 | WP_000809857.1 | hypothetical protein | - |
CH51_RS10115 | 2009032..2009208 | - | 177 | WP_000375476.1 | hypothetical protein | - |
CH51_RS10120 | 2009219..2009602 | - | 384 | WP_000070811.1 | hypothetical protein | - |
CH51_RS10130 | 2010206..2010349 | - | 144 | WP_001549059.1 | transposase | - |
CH51_RS16455 | 2010552..2010647 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2010675..2010734 | - | 60 | - | - | Antitoxin |
CH51_RS10135 | 2010770..2010871 | + | 102 | WP_001791893.1 | hypothetical protein | - |
CH51_RS16030 | 2010849..2011025 | - | 177 | Protein_1954 | transposase | - |
CH51_RS10140 | 2011219..2011596 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1973113..2091488 | 118375 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46544 WP_001801861.1 NZ_CP007499:2010552-2010647 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46544 NZ_CP007499:2010552-2010647 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT46544 NZ_CP007499:c2010734-2010675 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|