Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 15382..15640 | Replicon | chromosome |
Accession | NZ_CP007442 | ||
Organism | Escherichia coli ACN001 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | J444_RS00080 | Protein ID | WP_000809168.1 |
Coordinates | 15382..15534 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 15583..15640 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J444_RS00060 | 10623..11336 | - | 714 | WP_001102383.1 | acidic protein MsyB | - |
J444_RS00065 | 11362..11766 | - | 405 | WP_000843559.1 | DUF2541 family protein | - |
J444_RS00070 | 12143..14059 | + | 1917 | WP_000516131.1 | molecular chaperone DnaK | - |
J444_RS00075 | 14148..15278 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
J444_RS00080 | 15382..15534 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 15583..15640 | + | 58 | - | - | Antitoxin |
J444_RS00085 | 16120..17286 | + | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
J444_RS00090 | 17352..18251 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
J444_RS26810 | 18290..19248 | - | 959 | Protein_17 | fimbrial family protein | - |
J444_RS00105 | 19261..20592 | - | 1332 | Protein_18 | fimbria/pilus outer membrane usher protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T46422 WP_000809168.1 NZ_CP007442:c15534-15382 [Escherichia coli ACN001]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T46422 NZ_CP007442:c15534-15382 [Escherichia coli ACN001]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT46422 NZ_CP007442:15583-15640 [Escherichia coli ACN001]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|