Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 1954525..1954746 | Replicon | chromosome |
| Accession | NZ_CP007393 | ||
| Organism | Escherichia coli strain ST2747 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | CF59_RS09350 | Protein ID | WP_000176713.1 |
| Coordinates | 1954525..1954632 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 1954680..1954746 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CF59_RS09325 | 1950370..1951452 | + | 1083 | WP_025210407.1 | peptide chain release factor 1 | - |
| CF59_RS09330 | 1951452..1952285 | + | 834 | WP_001578206.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| CF59_RS09335 | 1952282..1952674 | + | 393 | WP_000200377.1 | invasion regulator SirB2 | - |
| CF59_RS09340 | 1952678..1953487 | + | 810 | WP_025210408.1 | invasion regulator SirB1 | - |
| CF59_RS09345 | 1953523..1954377 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| CF59_RS09350 | 1954525..1954632 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1954680..1954746 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 1954680..1954746 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 1954682..1954745 | + | 64 | NuclAT_38 | - | - |
| - | 1954682..1954745 | + | 64 | NuclAT_38 | - | - |
| - | 1954682..1954745 | + | 64 | NuclAT_38 | - | - |
| - | 1954682..1954745 | + | 64 | NuclAT_38 | - | - |
| - | 1954682..1954745 | + | 64 | NuclAT_40 | - | - |
| - | 1954682..1954745 | + | 64 | NuclAT_40 | - | - |
| - | 1954682..1954745 | + | 64 | NuclAT_40 | - | - |
| - | 1954682..1954745 | + | 64 | NuclAT_40 | - | - |
| CF59_RS09355 | 1955060..1955167 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 1955220..1955281 | + | 62 | NuclAT_37 | - | - |
| - | 1955220..1955281 | + | 62 | NuclAT_37 | - | - |
| - | 1955220..1955281 | + | 62 | NuclAT_37 | - | - |
| - | 1955220..1955281 | + | 62 | NuclAT_37 | - | - |
| - | 1955220..1955281 | + | 62 | NuclAT_39 | - | - |
| - | 1955220..1955281 | + | 62 | NuclAT_39 | - | - |
| - | 1955220..1955281 | + | 62 | NuclAT_39 | - | - |
| - | 1955220..1955281 | + | 62 | NuclAT_39 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_14 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_14 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_14 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_14 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_16 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_16 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_16 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_16 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_18 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_18 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_18 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_18 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_20 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_20 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_20 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_20 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_22 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_22 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_22 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_22 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_24 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_24 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_24 | - | - |
| - | 1955220..1955282 | + | 63 | NuclAT_24 | - | - |
| CF59_RS09360 | 1955573..1956673 | - | 1101 | WP_001366250.1 | sodium-potassium/proton antiporter ChaA | - |
| CF59_RS09365 | 1956943..1957173 | + | 231 | WP_001578208.1 | putative cation transport regulator ChaB | - |
| CF59_RS09370 | 1957331..1958026 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| CF59_RS09375 | 1958070..1958423 | - | 354 | WP_001578209.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T46353 WP_000176713.1 NZ_CP007393:c1954632-1954525 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T46353 NZ_CP007393:c1954632-1954525 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT46353 NZ_CP007393:1954680-1954746 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|