Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 1946772..1946993 Replicon chromosome
Accession NZ_CP007392
Organism Escherichia coli strain ST2747

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag CF58_RS09350 Protein ID WP_000176713.1
Coordinates 1946772..1946879 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 1946927..1946993 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CF58_RS09325 1942617..1943699 + 1083 WP_025210407.1 peptide chain release factor 1 -
CF58_RS09330 1943699..1944532 + 834 WP_001578206.1 peptide chain release factor N(5)-glutamine methyltransferase -
CF58_RS09335 1944529..1944921 + 393 WP_000200377.1 invasion regulator SirB2 -
CF58_RS09340 1944925..1945734 + 810 WP_025210408.1 invasion regulator SirB1 -
CF58_RS09345 1945770..1946624 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CF58_RS09350 1946772..1946879 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1946927..1946993 + 67 NuclAT_13 - Antitoxin
- 1946927..1946993 + 67 NuclAT_13 - Antitoxin
- 1946927..1946993 + 67 NuclAT_13 - Antitoxin
- 1946927..1946993 + 67 NuclAT_13 - Antitoxin
- 1946927..1946993 + 67 NuclAT_15 - Antitoxin
- 1946927..1946993 + 67 NuclAT_15 - Antitoxin
- 1946927..1946993 + 67 NuclAT_15 - Antitoxin
- 1946927..1946993 + 67 NuclAT_15 - Antitoxin
- 1946927..1946993 + 67 NuclAT_17 - Antitoxin
- 1946927..1946993 + 67 NuclAT_17 - Antitoxin
- 1946927..1946993 + 67 NuclAT_17 - Antitoxin
- 1946927..1946993 + 67 NuclAT_17 - Antitoxin
- 1946927..1946993 + 67 NuclAT_19 - Antitoxin
- 1946927..1946993 + 67 NuclAT_19 - Antitoxin
- 1946927..1946993 + 67 NuclAT_19 - Antitoxin
- 1946927..1946993 + 67 NuclAT_19 - Antitoxin
- 1946927..1946993 + 67 NuclAT_21 - Antitoxin
- 1946927..1946993 + 67 NuclAT_21 - Antitoxin
- 1946927..1946993 + 67 NuclAT_21 - Antitoxin
- 1946927..1946993 + 67 NuclAT_21 - Antitoxin
- 1946927..1946993 + 67 NuclAT_23 - Antitoxin
- 1946927..1946993 + 67 NuclAT_23 - Antitoxin
- 1946927..1946993 + 67 NuclAT_23 - Antitoxin
- 1946927..1946993 + 67 NuclAT_23 - Antitoxin
- 1946929..1946992 + 64 NuclAT_38 - -
- 1946929..1946992 + 64 NuclAT_38 - -
- 1946929..1946992 + 64 NuclAT_38 - -
- 1946929..1946992 + 64 NuclAT_38 - -
- 1946929..1946992 + 64 NuclAT_40 - -
- 1946929..1946992 + 64 NuclAT_40 - -
- 1946929..1946992 + 64 NuclAT_40 - -
- 1946929..1946992 + 64 NuclAT_40 - -
CF58_RS09355 1947307..1947414 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1947467..1947528 + 62 NuclAT_37 - -
- 1947467..1947528 + 62 NuclAT_37 - -
- 1947467..1947528 + 62 NuclAT_37 - -
- 1947467..1947528 + 62 NuclAT_37 - -
- 1947467..1947528 + 62 NuclAT_39 - -
- 1947467..1947528 + 62 NuclAT_39 - -
- 1947467..1947528 + 62 NuclAT_39 - -
- 1947467..1947528 + 62 NuclAT_39 - -
- 1947467..1947529 + 63 NuclAT_14 - -
- 1947467..1947529 + 63 NuclAT_14 - -
- 1947467..1947529 + 63 NuclAT_14 - -
- 1947467..1947529 + 63 NuclAT_14 - -
- 1947467..1947529 + 63 NuclAT_16 - -
- 1947467..1947529 + 63 NuclAT_16 - -
- 1947467..1947529 + 63 NuclAT_16 - -
- 1947467..1947529 + 63 NuclAT_16 - -
- 1947467..1947529 + 63 NuclAT_18 - -
- 1947467..1947529 + 63 NuclAT_18 - -
- 1947467..1947529 + 63 NuclAT_18 - -
- 1947467..1947529 + 63 NuclAT_18 - -
- 1947467..1947529 + 63 NuclAT_20 - -
- 1947467..1947529 + 63 NuclAT_20 - -
- 1947467..1947529 + 63 NuclAT_20 - -
- 1947467..1947529 + 63 NuclAT_20 - -
- 1947467..1947529 + 63 NuclAT_22 - -
- 1947467..1947529 + 63 NuclAT_22 - -
- 1947467..1947529 + 63 NuclAT_22 - -
- 1947467..1947529 + 63 NuclAT_22 - -
- 1947467..1947529 + 63 NuclAT_24 - -
- 1947467..1947529 + 63 NuclAT_24 - -
- 1947467..1947529 + 63 NuclAT_24 - -
- 1947467..1947529 + 63 NuclAT_24 - -
CF58_RS09360 1947820..1948920 - 1101 WP_001366250.1 sodium-potassium/proton antiporter ChaA -
CF58_RS09365 1949190..1949420 + 231 WP_001578208.1 putative cation transport regulator ChaB -
CF58_RS09370 1949578..1950273 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CF58_RS09375 1950317..1950670 - 354 WP_001578209.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T46323 WP_000176713.1 NZ_CP007392:c1946879-1946772 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T46323 NZ_CP007392:c1946879-1946772 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT46323 NZ_CP007392:1946927-1946993 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8


Antitoxin

Download structure file

References