Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4114563..4114832 | Replicon | chromosome |
Accession | NZ_CP007391 | ||
Organism | Escherichia coli strain ST540 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CF61_RS20625 | Protein ID | WP_001312861.1 |
Coordinates | 4114674..4114832 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 4114563..4114628 (+) |
Genomic Context
Location: 4110098..4110304 (207 bp)
Type: Others
Protein ID: WP_000275853.1
Type: Others
Protein ID: WP_000275853.1
Location: 4110330..4110869 (540 bp)
Type: Others
Protein ID: WP_000290839.1
Type: Others
Protein ID: WP_000290839.1
Location: 4110932..4111165 (234 bp)
Type: Others
Protein ID: WP_000005990.1
Type: Others
Protein ID: WP_000005990.1
Location: 4111231..4113189 (1959 bp)
Type: Others
Protein ID: WP_025269850.1
Type: Others
Protein ID: WP_025269850.1
Location: 4113244..4113678 (435 bp)
Type: Others
Protein ID: WP_001470779.1
Type: Others
Protein ID: WP_001470779.1
Location: 4113675..4114394 (720 bp)
Type: Others
Protein ID: WP_001276232.1
Type: Others
Protein ID: WP_001276232.1
Location: 4114406..4114630 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 4114406..4114630 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 4114406..4114630 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 4114406..4114630 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 4114563..4114628 (66 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 4114674..4114832 (159 bp)
Type: Toxin
Protein ID: WP_001312861.1
Type: Toxin
Protein ID: WP_001312861.1
Location: 4115523..4115729 (207 bp)
Type: Others
Protein ID: WP_000547974.1
Type: Others
Protein ID: WP_000547974.1
Location: 4115754..4116041 (288 bp)
Type: Others
Protein ID: WP_000107535.1
Type: Others
Protein ID: WP_000107535.1
Location: 4116160..4116981 (822 bp)
Type: Others
Protein ID: WP_025269852.1
Type: Others
Protein ID: WP_025269852.1
Location: 4118202..4118585 (384 bp)
Type: Others
Protein ID: WP_025269854.1
Type: Others
Protein ID: WP_025269854.1
Location: 4118776..4119462 (687 bp)
Type: Others
Protein ID: WP_025269855.1
Type: Others
Protein ID: WP_025269855.1
Location: 4119556..4119783 (228 bp)
Type: Others
Protein ID: WP_001254386.1
Type: Others
Protein ID: WP_001254386.1
Location: 4114406..4114594 (189 bp)
Type: Others
Protein ID: WP_001299721.1
Type: Others
Protein ID: WP_001299721.1
Location: 4117278..4117787 (510 bp)
Type: Others
Protein ID: WP_025269853.1
Type: Others
Protein ID: WP_025269853.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CF61_RS28465 | 4110098..4110304 | + | 207 | WP_000275853.1 | hypothetical protein | - |
CF61_RS20595 | 4110330..4110869 | + | 540 | WP_000290839.1 | single-stranded DNA-binding protein | - |
CF61_RS20600 | 4110932..4111165 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
CF61_RS20605 | 4111231..4113189 | + | 1959 | WP_025269850.1 | ParB/RepB/Spo0J family partition protein | - |
CF61_RS20610 | 4113244..4113678 | + | 435 | WP_001470779.1 | conjugation system SOS inhibitor PsiB | - |
CF61_RS20615 | 4113675..4114394 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
CF61_RS28265 | 4114406..4114594 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 4114406..4114630 | + | 225 | NuclAT_0 | - | - |
- | 4114406..4114630 | + | 225 | NuclAT_0 | - | - |
- | 4114406..4114630 | + | 225 | NuclAT_0 | - | - |
- | 4114406..4114630 | + | 225 | NuclAT_0 | - | - |
- | 4114563..4114628 | + | 66 | - | - | Antitoxin |
CF61_RS20625 | 4114674..4114832 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CF61_RS28470 | 4115523..4115729 | + | 207 | WP_000547974.1 | hypothetical protein | - |
CF61_RS20640 | 4115754..4116041 | + | 288 | WP_000107535.1 | hypothetical protein | - |
CF61_RS20645 | 4116160..4116981 | + | 822 | WP_025269852.1 | DUF945 domain-containing protein | - |
CF61_RS20650 | 4117278..4117787 | - | 510 | WP_025269853.1 | transglycosylase SLT domain-containing protein | - |
CF61_RS20655 | 4118202..4118585 | + | 384 | WP_025269854.1 | relaxosome protein TraM | - |
CF61_RS20660 | 4118776..4119462 | + | 687 | WP_025269855.1 | PAS domain-containing protein | - |
CF61_RS20665 | 4119556..4119783 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4073654..4117787 | 44133 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T46314 WP_001312861.1 NZ_CP007391:4114674-4114832 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T46314 NZ_CP007391:4114674-4114832 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT46314 NZ_CP007391:4114563-4114628 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | P11895 |