Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 468329..468554 | Replicon | chromosome |
| Accession | NZ_CP007275 | ||
| Organism | Escherichia coli strain O18 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A8S7B7V6 |
| Locus tag | NMECO18_RS02565 | Protein ID | WP_000813256.1 |
| Coordinates | 468399..468554 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 468329..468387 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMECO18_RS02530 | 463354..463596 | + | 243 | WP_000747951.1 | hypothetical protein | - |
| NMECO18_RS02535 | 463580..464005 | + | 426 | WP_000693867.1 | Rha family transcriptional regulator | - |
| NMECO18_RS02540 | 464077..465147 | + | 1071 | WP_001262357.1 | hypothetical protein | - |
| NMECO18_RS02545 | 465188..465610 | + | 423 | WP_001151216.1 | DUF977 family protein | - |
| NMECO18_RS02550 | 465802..466764 | + | 963 | WP_014639476.1 | hypothetical protein | - |
| NMECO18_RS02555 | 466780..467781 | + | 1002 | WP_000354966.1 | hypothetical protein | - |
| - | 468329..468387 | - | 59 | - | - | Antitoxin |
| NMECO18_RS02565 | 468399..468554 | + | 156 | WP_000813256.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| NMECO18_RS02570 | 468722..469000 | + | 279 | WP_011478175.1 | hypothetical protein | - |
| NMECO18_RS02575 | 469002..470048 | + | 1047 | WP_001265108.1 | DUF968 domain-containing protein | - |
| NMECO18_RS02580 | 470061..470435 | + | 375 | WP_000904114.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NMECO18_RS02585 | 470432..471253 | + | 822 | WP_000762880.1 | antitermination protein | - |
| NMECO18_RS02590 | 471478..471675 | + | 198 | WP_000917749.1 | hypothetical protein | - |
| NMECO18_RS02595 | 471826..472875 | + | 1050 | WP_000935515.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 452736..505276 | 52540 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5764.94 Da Isoelectric Point: 6.1531
>T46244 WP_000813256.1 NZ_CP007275:468399-468554 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTVYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTVYEPEE
Download Length: 156 bp
>T46244 NZ_CP007275:468399-468554 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGTTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGTTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT46244 NZ_CP007275:c468387-468329 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|