Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2314301..2314518 | Replicon | chromosome |
Accession | NZ_CP007176 | ||
Organism | Staphylococcus aureus USA300-ISMMS1 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | AZ30_RS11900 | Protein ID | WP_001802298.1 |
Coordinates | 2314414..2314518 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2314301..2314356 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AZ30_RS11880 | 2310438..2311103 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
AZ30_RS11885 | 2311255..2311575 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
AZ30_RS11890 | 2311577..2312557 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
AZ30_RS11895 | 2312823..2313914 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2314301..2314356 | + | 56 | - | - | Antitoxin |
AZ30_RS11900 | 2314414..2314518 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
AZ30_RS16120 | 2314679..2315162 | - | 484 | Protein_2263 | recombinase family protein | - |
AZ30_RS11910 | 2315205..2316341 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
AZ30_RS11915 | 2316630..2316722 | + | 93 | WP_001790138.1 | hypothetical protein | - |
AZ30_RS11920 | 2317427..2318284 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
AZ30_RS11925 | 2318352..2319134 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T46147 WP_001802298.1 NZ_CP007176:c2314518-2314414 [Staphylococcus aureus USA300-ISMMS1]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T46147 NZ_CP007176:c2314518-2314414 [Staphylococcus aureus USA300-ISMMS1]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46147 NZ_CP007176:2314301-2314356 [Staphylococcus aureus USA300-ISMMS1]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|